KEGG   Panthera tigris altaica (Amur tiger): 102964670Help
Entry
102964670         CDS       T02988                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Serotonergic synapse
Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102964670 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    102964670 (PTGS1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102964670 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    102964670 (PTGS1)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102964670 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 714 aa AA seqDB search
MVPTQRWSGAGGEMCMSVLRARDLQSKRKLSACWKCLAIARAWRLSSSAEMLLFLPPSGT
FLGKGGLCCHLVATVRPPRVLRKPGRRQSKNSELLREAAPEWLDVQGVTGLGGGSGRICR
PSYKIEELDLGVPESRQVDPGSPLPLLLLLQVLQPPQVLPADSRAPAPVNPCCYYPCQHQ
GICVRFGLDRYQCDCTRTGYSGPNCTIPELWTWLRNSLRPSPAFLHFLLSQVVRSNLIPS
PPTYNIAHDYISWESFSNMSYYTLILPSVPQDCPMPMGTKGKKQLPDAQILGHRFLLRRK
FIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRL
FKDGKLKYQVLHGEMYPPSVEEAPVLMHYPRNIPPQSQMAVGQEVFGLLPGLMLYATLWL
REHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVVEEYVQQLSGYFLQLKFDPELL
FGVQFQYQNRIAMEFNQLYHWHPLMPDSFKVGSREYSYEQFLFNTSMLVDYGVEALVDAF
SRQRAGQIGGGRNMDHHVLHVAVDVIKESRELRLQPFNEYRKRFGLRPYTSFQELTGEKE
MAAELEELYGDIDALEFFPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWK
PSTFGGEMGFNMVKTATLKKLVCLNTKTCPYVSFHVPDPHQDDGPGVERPSTEL
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggtccccacccagaggtggtcaggagcagggggagagatgtgcatgagcgtacttaga
gcacgagatcttcagagcaagaggaagctctcggcttgttggaagtgcctcgccatagca
agggcttggcgactgagctccagcgcagagatgctcctttttcttcctccttcggggact
tttctcggaaaaggaggcctatgctgccacctggtggcaactgtgagacctcctagggtt
ctgaggaagcccggccggcgccagtccaagaactctgagctgctgagggaggcagcccca
gagtggttagatgtgcagggagtcacgggcttaggaggaggtagtgggaggatctgtcgc
cccagctataaaatcgaggagctggatcttggtgttccggaaagtcggcaggtagatccc
gggtccccgctgcccctgctgctgctgctgcaggtcctgcagccgccccaggtcctgccc
gcggattcccgggcccccgcgccggtgaatccatgctgttactacccatgccaacaccag
gggatctgtgtccgcttcggccttgaccgctaccagtgtgactgcacccgcacgggatat
tctggccccaactgcaccatccctgagctatggacctggctccggaattcactgcgaccc
agccccgctttcctccacttcctgctgtcacaggtggtgcgttccaaccttatccccagc
cctcccacctacaacatagcgcatgactacatcagctgggagtccttctccaacatgagc
tattatactcttattctgccctccgtgccccaagactgccccatgcccatgggaaccaaa
gggaagaagcagttgccagatgcccagattctgggccatcgcttcctgctcaggaggaag
ttcatacctgaccctcaaggaaccaacctcatgttcgccttctttgcacaacacttcacc
caccagttcttcaaaacttctggcaagatgggtcctggcttcaccaaggccttgggacac
ggggtagatctcggccacatttatggggacaacctggaacgtcagtatcagctgcggctc
tttaaggatgggaaactcaaataccaggtgctgcacggagagatgtacccgccatcggtg
gaggaggcgccggtgttgatgcactacccacgaaacattccaccccagagccagatggct
gtgggtcaggaggtgtttgggctgcttcccgggctcatgctctatgccacgctctggctg
cgtgagcacaaccgcgtgtgtgacctgctgaaggctgagcaccccacctggggtgatgag
caactcttccagacggcccgcctcatccttatcggggagaccatcaagattgtggttgag
gagtatgtgcagcagttgagcggttacttcctgcagctgaagtttgacccagagctgctg
ttcggcgtccagttccagtaccaaaaccgcattgccatggagttcaaccagctgtaccac
tggcacccgctcatgcctgactccttcaaggtgggctcccgggagtacagctacgagcag
ttcctgttcaacacctccatgctggtggactatggggtcgaggccctggtggacgccttc
tctcgccagagagctggccagattggtgggggtaggaacatggaccaccatgtcttgcat
gtggctgtcgatgtcatcaaggaatcccgtgagctgcggctgcagcccttcaatgaatac
cgcaagaggttcggcctgagaccctacacgtcctttcaggagctcacaggagagaaggag
atggcagccgagttggaggagctgtatggagacatcgatgccttggagttcttcccgggg
ctgcttctggagaagtgccatccaaattccatctttggggagagtatgatagaaattggg
gcccctttttctctcaagggcctcctagggaatcccatctgttctccagagtattggaag
ccaagcacatttggtggtgagatgggcttcaatatggtcaagacagccacgctgaagaag
ttggtctgcctcaacaccaagacttgtccctacgtttccttccatgtgcccgacccccac
caggatgatgggcctggtgtggagcggccatctacagagctctga

DBGET integrated database retrieval system