KEGG   Panthera tigris altaica (Amur tiger): 102965643Help
Entry
102965643         CDS       T02988                                 

Gene name
UCHL3
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102965643 (UCHL3)
Peptidases [BR:ptg01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102965643 (UCHL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 230 aa AA seqDB search
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcagcgttggctgccgctggaggccaatcccgaggtcaccaaccagtttctc
aaacaattaggtctacatcctaactggcagtttgttgatgtatatggaatggatcctgaa
cttcttagcatggtaccaagaccagtgtgtgcagtgttacttctcttccctattacagaa
aagtatgaagtattcagaacagaggaggaggaaaaaataaagtctcagggacaagatgtt
acgtcatcagtatatttcatgaagcaaacaatcagcaatgcctgcggaacaattggactc
atccatgctattgccaacaataaagacaagatgcactttgaatctggatcaaccttgaaa
aaattcctagaggagtctgtgtcaatgagccctgaagaacgagccagatacctagagaac
tatgacgctatccgagtcactcatgagaccagtgcccatgaaggtcagactgaggcacca
agtatagatgaaaaagtagatcttcattttattgcattagttcatgtagatgggcatctc
tatgaattagatggacggaaaccatttccaattaaccatggggaaactagtgatgaaact
ttattagaggatgccatagaagtttgcaagaagtttatggaacgtgaccctgatgaattg
aggttcaatgcaattgctctatctgcagcatag

DBGET integrated database retrieval system