KEGG   Panthera tigris altaica (Amur tiger): 102965789Help
Entry
102965789         CDS       T02988                                 

Gene name
TGM7
Definition
transglutaminase 7
Orthology
K05623  
transglutaminase 7 [EC:2.3.2.13]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
Enzymes [BR:ptg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102965789 (TGM7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 786 aa AA seqDB search
MFQNAWGGFRGEVDAEFYWKNRDSGDVDPYIQRFGGHNMNEAEFMGYLAALKFRSVDLQS
PRNNQEHHTQEMGLKRLVVRRGQSFLLQLHFSRPFHFGTDYLTFVAETGPAPTELLGTRA
TFSLTQARQGNVWSASNFTIDTNSLFVSLFTPSNAVVGPYTLKIEISQGQGHSVTHPLGT
FILLFNPWNAEDDVYLPSEILLQEYIMMDYGFVYKGHERFITSWPWNYGQFEEDIIDICF
EILNKSLYFLENPSKDYSQRNDPVYVCRVVSAMINSNDDNGVLQGNWGEDYSRGVSPLEW
NGSVAILRQWLARGRQPVKYGQCWVFAAVMCTVMRCLGIPTRVVSNFRSAHNMDRNLTVD
TYYDQNAEMLPTQKRDKIWNFHVWNECWMIRKDLPPGYNGWQVLDPTPQQTSSGIFCCGP
ASVKAIREGEVHLPYDTPFVYAEVNADEVIWLFRDGQAQEILDHNTHSIGKEISTKMVGS
AKRQNITSSYKYPEGSPEERSVFMKASQKMLGPGRASSPFLDLLGSRGSQDQPAQLQLHL
ARTPEWGQDLLLKLHALRVPDRVHPRGPIRLVVHFCAQALLHQGGTQEPLWRQTVHLNLD
FGEEIQWPLLLPYDNYRNKLTDEKLIRVSGIAKVEDVGRSMLVLKDISLEPPNLSIEVSK
RAEVGKALRVHITLTNTLMTALSNCMMVLEGSGLIDGQISKNIGTLVAGHTIHIQLDLYP
IKTGPRQLQVLISSNEIKEIKGYKDIFVAAARVSSAPPRPAPYSPNHPLPSLPEPSTLPT
APLFIP
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgttccaaaatgcttggggaggatttcgtggagaagtggatgctgagttttactggaaa
aatcgagacagtggggatgtagatccctacatccagaggtttggaggccacaacatgaat
gaagcagagtttatgggctacctggcagccttgaagttcaggtctgtggacttgcagagc
ccaagaaacaaccaggagcatcacacacaggagatgggcctgaagcggcttgttgtacgc
cggggccagtcctttctgctccaactacatttcagccgacccttccactttgggacagac
tacctcacctttgtggctgagacgggaccagcgcccacggaattgctgggaacccgagcc
accttctcccttacccaggctcgacaagggaatgtctggagtgcttctaacttcaccatt
gacaccaactcactctttgtctccctttttacaccatccaatgcagtcgttggtccctac
actctgaagatagagatctctcagggccagggtcacagtgtgactcacccattgggaact
ttcatcctgctttttaacccttggaatgcagaggatgatgtctacctgccaagtgaaata
ctattgcaggagtatatcatgatggactatggctttgtttacaagggtcatgaaagattc
atcacctcctggccctggaactatgggcagtttgaagaggacatcatagatatctgcttt
gagatcttgaacaagagcctgtacttcttagagaacccatccaaagactactcccagcgg
aatgaccctgtgtacgtctgcagggtggtgagtgccatgatcaacagcaacgatgacaac
ggtgtgctgcagggaaactggggagaggactactccaggggggtcagcccgctggagtgg
aatggcagcgtagccatcctgcggcagtggttagccaggggcaggcagcctgtgaagtat
ggacagtgctgggtctttgcagctgtgatgtgcacagtaatgagatgtttaggtattcca
acccgtgtggtttccaattttcgttctgcacacaacatggacaggaacttgaccgtcgac
acctactatgaccaaaatgcagagatgctgcctactcagaagcgagacaaaatatggaat
tttcatgtctggaatgagtgctggatgatccggaaagatctcccaccaggatacaatggg
tggcaagttctggaccccactccccagcaaaccagcagcgggatattctgctgcggccct
gcttctgtgaaggccatcagggaaggggaggttcacctgccctatgacaccccatttgtg
tacgccgaggtgaatgctgatgaagtcatttggctcttcagagatggtcaggcccaggaa
atcctggaccataatacccattccattgggaaggaaatcagcaccaagatggtagggtca
gctaagcgacagaacattaccagctcctacaagtatccagaaggatcccctgaggagcga
tctgtgttcatgaaggcttcccagaaaatgctgggcccaggaagggcctcctcacccttc
ctggatctgctggggtccagggggtctcaggatcagccagcccagctgcagcttcacctg
gccaggacgcctgagtggggccaggacctgttgctgaagctgcatgccctgagggtgcca
gacagagtccacccccggggtcccatcagactggtggtgcacttctgcgcacaggccctg
ctgcaccagggtggcacccaggagcccctctggaggcaaacagtgcacttgaacctggac
tttggggaggagatacagtggccgctcttgctaccctacgacaattatagaaacaagctg
acagatgagaagctgatccgtgtgtctggcattgccaaggtggaggatgtggggaggtcc
atgctggtcctaaaagatatctctctggaacctcccaatttatctattgaggtgtctaaa
agggccgaggtgggcaaggcactgagagtccacatcaccctcaccaataccctaatgact
gctctgagtaactgcatgatggtgctggagggaagtggcctcattgatgggcagatatcc
aaaaacattgggactctggtggctggacacaccatccacattcaactggacctctacccc
atcaaaactggaccacgccagctgcaagtcctcatcagcagcaacgagatcaaggagatc
aagggctataaggacatctttgttgctgcagccagggtttcttcagccccgccccgccct
gccccgtactctcccaaccaccccctcccgtctctccctgagcccagcacccttcctact
gctcccctcttcatcccctag

DBGET integrated database retrieval system