KEGG   Panthera tigris altaica (Amur tiger): 102966019Help
Entry
102966019         CDS       T02988                                 

Gene name
SCD5
Definition
stearoyl-CoA desaturase 5
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    102966019 (SCD5)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102966019 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    102966019 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102966019 (SCD5)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     102966019 (SCD5)
Lipid biosynthesis proteins [BR:ptg01004]
 Desaturase
  First
   102966019 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 276 aa AA seqDB search
MAESPLERDPGSPGLHLEFTLLWAYFCFLLSALGVTAGAHRLWSHRSYKAKLPLRIFLAV
ANSMAFQNDIFEWSRDHRVHHKYSETDADPHNARRGFFFSHIGWLFVRKHPDVIEKGRKL
DLTDLLADPVVRFQRKYYKITVVLMCFVIPTLVPWCAWEESLWNSYFLASILRYTISLNI
SWLVNSAAHMYGNRPYDKHISPRQNPLVTLGAIGEGFHNYHHTFPFDYSASEFGLNFNPT
TWFIDLMCWLGLATDRKRATKPMIKARKARTGDGST
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatcacctctggagagagatcctggctctcctggccttcatctcgaattcact
ctgctctgggcgtacttctgcttcctcctatctgctctgggtgtgacagctggtgcccat
cgcttgtggagccacaggtcctacaaagccaagctgcctctgaggatatttctggctgtt
gccaactccatggctttccagaatgacatcttcgagtggtccagggaccaccgagtccac
cacaagtactcagagaccgatgctgacccacacaatgcccgtcggggcttcttcttctct
catatcgggtggctctttgttcgcaaacatccagatgtcattgagaaggggagaaaactt
gacctcactgacctgctggctgatcctgtggtccgattccagagaaagtactataagatc
accgtggtgctcatgtgctttgtgatccccacgctggtaccctggtgtgcctgggaagag
agtctgtggaactcctacttcttggcctccatcctccgctataccatctcactcaacatc
agctggctggtcaacagtgctgcccacatgtatggaaaccggccctacgacaagcacatc
agccctcggcagaacccactcgtcaccctgggtgccattggtgaaggcttccacaattac
caccacacctttccctttgactactctgcgagtgaatttggcttaaatttcaacccaacc
acttggttcattgacctcatgtgctggctgggactggccactgaccgcaaacgagcaacc
aagccaatgatcaaggcccggaaagccaggactggagacggcagcacttga

DBGET integrated database retrieval system