KEGG   Panthera tigris altaica (Amur tiger): 102967736Help
Entry
102967736         CDS       T02988                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Cholesterol metabolism
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102967736 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102967736 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    102967736 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    102967736 (LPL)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102967736 (LPL)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102967736 (LPL)
  Exosomal proteins of breast milk
   102967736 (LPL)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   102967736 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ptg00537]
 Enzymes
  102967736 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 445 aa AA seqDB search
MESKTLFLMALGIWLQILTTTRGWVAADDRITGGRDFIDIESKFALRTPEDIAEDTCHLI
PGVTESVANCHFNHTSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRA
QQHYPVSAGYTKLVGKDVAKFINWMAEEFHYPLDNVHLLGYSLGAHAAGIAGSLTNKKVN
RITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG
TFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAF
EKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESDTQ
TNQVFEISLYGTVAESENIPFTLPEISANKTYSFLIYTEVDIGELLMLKLKWKSDSYFSW
SDWWSSPGFTIEKIRVKAGETQKKR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaaaccctgttcctgatggctctgggcatatggctccagattctgaccacc
acccgtggatgggtggctgccgacgacagaattacaggaggaagagattttatagatatt
gaaagtaaatttgctctaaggacccctgaagacatagctgaagatacttgccacctcatt
cctggagtgacagaatctgtggctaactgccacttcaaccacaccagcaaaacctttgtg
gtgatccatggctggacggtgacaggaatgtatgagagttgggtgccaaaacttgtggct
gccctgtacaagagggaaccagattccaatgtcattgtggtggactggctgtcacgggcc
cagcagcattatccggtgtctgcgggatacaccaagctggtgggaaaggatgtggccaag
tttatcaactggatggcggaggaatttcactatcctctggacaatgtccatctcttggga
tacagccttggagctcatgctgctggcattgcaggaagtctgaccaataagaaggtcaat
agaattactggactagatccagctggacctaactttgaatatgcagaagctccaagtcgc
ctttctcctgatgatgcagattttgtagatgtcttacacacattcaccagagggtcacct
ggccgaagtattggaatccagaaaccagtaggacatgttgacatttatcctaatggaggc
acttttcaaccgggatgtaacattggggaagctatccgtgtgattgcagagagaggcctt
ggagatgtggaccagctagtgaagtgttcccatgagcgctccattcatctctttattgat
tctctgttgaatgaagaaaacccgagtaaggcctaccggtgcaattcaaaggaagccttt
gagaaagggctttgtctgagttgtagaaaaaaccgttgcaacaatttgggttatgagatc
aataaggtcagagccaaaagaagcagcaaaatgtacctgaagactcggtctcagatgcct
tacaaagtcttccattaccaagtaaagatacatttttctgggactgagagtgatacacag
accaaccaggtctttgagatttctctgtatggcactgtggctgagagtgagaacattcct
ttcaccctgcctgaaatttctgcgaataagacatactcttttctaatttacacggaagtg
gatattggggaactgctaatgttgaaactcaaatggaagagcgattcatacttcagctgg
tcagactggtggagcagccctgggtttactattgagaagatcagagtaaaagcaggagag
actcaaaaaaaaaggtaa

DBGET integrated database retrieval system