KEGG   Panthera tigris altaica (Amur tiger): 102969433Help
Entry
102969433         CDS       T02988                                 

Gene name
ALDH1L2
Definition
(RefSeq) aldehyde dehydrogenase 1 family member L2
  KO
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    102969433 (ALDH1L2)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     102969433 (ALDH1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 936 aa AA seqDB search
MVNAQNMFIEHVLHTSGMIWSTMCHMFHKAYFKNKLKLALIGQSLFGQEVYSHLRKEGHR
VVGVFTVPDKDGKADPLALAAEKDGTPVFKFPRWRVKGKTIKEVAEAYKSVGAELNVLPF
CTQFIPMDVIDSPKYGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGP
ILLQKSCDVEPNDTVDALYNRFLFPEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQK
KENAEISWDQSAEVLHNWIRGHDKVPGAWTEIHGQMVTFYGSSLLKSSVPSGEPLEIKGA
TKPGLVTKNGLVLFGNDGKALMVRNLQFEDGRMIPASQYFSAGETSVLELTAEEMKVAGT
IKDIWAGILSNVPVIEDSTDFFKSGASSMDVVRLVEEIRQKCGGLQLQNEDVYLATKFED
FIQKVVRKLRGEESEEELVVDYVSKEVNEMTVKMPYQCFINGQFTDADDGKTYDTINPTD
GSIICKVSYASLVDVDKAVAAAKDAFENGEWGRMNARERGRLMYRLADLLEENQEELATI
EALDSGAVYTLALKTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGV
CAIIIPWNYPLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINII
PGSGGIAGQRLSEHPDIRKLGFTGSTAIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDC
ELDKAVRMGMGAVFFNKGENCIAAGRLFVEEAIHDEFVTRVVEEIKKMKIGDPLDRSTDH
GPQNHKAHLEKLLQYCEAGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDHMYLAKEESF
GPIMVISKFQNGDIDGVLQRANNTEYGLASGVFTRDINKAMYVSEKLEAGTVFVNTYNKT
DVAAPFGGVKQSGFGKDLGEEALNEYLKTKTVTLEY
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatgctcagaacatgttcattgagcacgtcttgcacacgtcaggcatgatttgg
agcaccatgtgccacatgttccacaaggcctatttcaaaaacaagctgaagctggcactt
attggtcagagccttttcggacaggaagtgtacagtcacctccgcaaagagggccaccga
gttgtgggcgtgttcacggttccagacaaggacggcaaagctgacccgctggctttagct
gcagagaaagatgggacccccgtgttcaagttccccagatggagagtcaagggcaagacc
ataaaggaggtggcagaggcctacaaatctgtgggtgctgagctaaacgtacttcccttc
tgcacacagtttatccccatggatgtaattgacagcccaaagtacggctctatcatatat
cacccctccatccttcccaggcatagaggagcctctgctatcaactggactctaattatg
ggagataagaaagctgggttttctgttttctgggctgatgatggtttagacacaggaccc
atccttcttcagaagtcatgtgatgttgaacccaatgatacagtggatgcactttataat
cggtttctctttcctgaaggaatcaaagccatggtggaagctgttcaactcatagccgat
ggaaaagctcctcgcattccccaaccagaagaaggagcaacatatgaaggcatccagaaa
aaggaaaatgctgagatttcttgggatcagtctgccgaagttttgcataactggatccga
ggtcatgataaagtccctggagcttggacagagatacatggacagatggtcacgttttat
ggctcgtcattgctgaaaagctccgtgccttctggagaaccactggaaatcaaaggtgcc
acgaagcctggtcttgttaccaaaaatggacttgttctttttggtaatgatggaaaagca
ctgatggtgaggaatttgcagtttgaagatggaagaatgattccagcctctcagtacttt
tcagcgggtgagacctcagtgctagaacttacagccgaagagatgaaggtggcagggacc
atcaaggacatctgggctggaattttaagcaacgtccctgttattgaagactcgacagac
ttctttaaatctggagcaagctcaatggatgttgtcaggctggttgaagagatcagacag
aagtgcggtgggcttcaactacagaatgaagatgtctatctggccaccaagtttgaagac
ttcattcagaaagttgtgaggaaactgagaggagaagaatcggaagaggagctggtggtg
gattatgtttcaaaggaggtcaatgaaatgacagtgaaaatgccatatcagtgtttcata
aatggacagttcacagatgctgatgatggaaagacctatgatactatcaacccaacagac
ggatctataatatgcaaagtatcctatgcttctttggtggatgttgataaagcagtagca
gcagcaaaagatgcctttgaaaacggtgaatggggaagaatgaatgcaagagaaagagga
aggttgatgtacagacttgcagacctactggaagagaaccaggaggagctggcaaccatt
gaagcccttgattcaggggctgtctacaccctggctctgaagactcacatcggaatgtct
gtgcaaacattcagatattttgctggctggtgtgacaaaattcagggttctactattcca
atcaaccaggcccgtccaaatcgcaatctgaccttcaccaagaaggagccgcttggggtc
tgcgccattatcatcccctggaattacccactgatgatgctggcgtggaaaagcgccgcg
tgtctggcagcgggtaacaccctagtgctcaagccagcgcaggtcacacccttgactgct
ttgaagtttgctgagctctccgtgaaagcaggctttcccaagggggtaatcaacatcatc
ccaggctcaggtggcatagctgggcaacgcctttctgaacatcctgatatccgtaaactt
ggtttcactgggtccactgctattggcaagcagatcatgaagagctgtgctgtgagcaac
ctgaagaaagtttcccttgaacttggtggcaaatccccacttataatattcaatgactgt
gaacttgacaaggccgtgagaatgggcatgggggcagtatttttcaacaaaggagagaac
tgtattgcagccgggcgcttgtttgtggaagaagccatccacgatgaatttgtgacaaga
gtggtggaagaaattaaaaagatgaaaattggtgatccacttgacagatctaccgatcac
gggccccaaaatcataaggcccatctggaaaagcttctgcaatactgtgaagctggagtg
aaagagggggccaccttggtgtacgggggaagacaagttcaaagaccaggcttttttatg
gaaccaactgtgttcacagatgtggaagaccacatgtatcttgccaaagaggaatcattt
gggcccataatggtcatttctaagttccaaaatggggacatcgatggagtgttgcagcga
gcaaataacacagagtacggtttggcctcaggggtttttacaagagacataaataaagcc
atgtacgtgagcgagaagctagaagcgggaactgttttcgttaacacctacaacaagacg
gacgtggccgcccctttcggtggggttaaacaatctggttttgggaaagacttaggtgag
gaagctctaaacgaatacctcaaaaccaagactgtgacgctggaatactag

DBGET integrated database retrieval system