KEGG   Panthera tigris altaica (Amur tiger): 102970987Help
Entry
102970987         CDS       T02988                                 

Gene name
NEU1
Definition
sialidase 1 (lysosomal sialidase)
Orthology
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
Other glycan degradation
Sphingolipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    102970987 (NEU1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    102970987 (NEU1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    102970987 (NEU1)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     102970987 (NEU1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 417 aa AA seqDB search
MMADRAGQVLLGRPGDPRMPGFWGGCRVQVLATIIFLLLLSLAESGARAKNDFSLVQPLV
TMEQLLWVSGRQIGSVHTFRIPLITTTPQGTLLAFAEARKMSTSDEGAKFIALRRSLDQG
STWSPTAFIVDDGDTPDGLNLGAVVNDMETGVVFLFYSLCAHKAGCQVASTMLVWSKDDG
VSWSPPRNLSLDIGTEMFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGA
TWRYGSGVSGIPYGQPKRENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDA
CDTIRPRDVTFDPELVDPVVAAGAVATSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRK
ETVQLWPGPSGYSSLAALEGNVGGKDQAPQLYVLYEKGRNQYTESISLAKVSVYGTL
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggatcgagccggacaagtgctcctgggcagacccggggacccgcggatgccg
gggttctggggaggctgtagagttcaggtattggccacgatcatcttcctgctgcttttg
tctctggcagaatctggcgctagggcaaagaatgacttcagcctggttcagccgctggtg
accatggagcagctgctgtgggtaagcgggaggcagatcggttctgtgcacaccttccga
attccgctcatcacaaccactcctcagggcactctccttgcctttgctgaggccagaaaa
atgtccacatcggatgagggggccaagttcattgctcttcgtaggtccttggaccaaggc
agcacatggtctcctacagccttcattgtagatgatggggacaccccggatgggctgaac
ctgggggcagtggtgaacgatatggagacaggagtggtgtttcttttctattccctctgt
gctcacaaggctggctgccaggtggcctccactatgttggtgtggagcaaagatgatggt
gtttcctggagccctccccggaacctctccttggatattggcaccgagatgtttgccccc
ggaccaggctcaggcattcagaaacagcgggagccgcggaagggccgcctcatcgtgtgt
ggccatgggacactggagcgggatggggtcttctgcctcctcagtgatgatcacggtgcc
acctggcgctatggcagtggggtcagcggcatcccctatggccagcccaagcgggaaaac
gatttcaaccctgatgagtgccagccctatgagctcccagatggctcagtcgtcatcaac
gcccggaaccagaacaactaccactgccattgccgaattgtcctccgcagctacgatgcc
tgtgataccatacggcctcgcgatgtgaccttcgaccctgagcttgtggaccctgtggta
gctgcaggagctgtagccaccagctccggcattgtcttcttctccaatccagcccatcca
gagttccgagtgaacctgaccctgcgttggagtttcagcaatggtacatcatggcggaaa
gagacagtccagctgtggccaggccccagtggctactcctcactggcagccctggagggc
aacgtaggcgggaaggaccaggccccccagctctacgtcctgtatgagaaaggccggaat
cagtacaccgagagtatctccctggccaaagtcagcgtgtatgggacactctga

DBGET integrated database retrieval system