KEGG   Panthera tigris altaica (Amur tiger): 102972398Help
Entry
102972398         CDS       T02988                                 

Definition
lysozyme C, milk isozyme-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    102972398
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102972398
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102972398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 142 aa AA seqDB search
MRSILIICLLGCFFAAYEAKIFXKCGLARKLKAEGMDGFHGYSLANWVCMAEHESNFNTQ
AFNGKNDNGSSDYGIFQINSKWWCKNNSSPSANACNTMCSRFLDDNISDDITCAKRVVKD
PNGMSAWVAWVRHCRYLASCNL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaggtccattctgatcatctgcctcctcggctgcttctttgcagcatatgaggccaaa
atcttcntcaagtgtgggctggcccgcaagctgaaggcagagggaatggatggcttccat
ggctacagcctggcaaactgggtctgcatggctgagcatgagagtaacttcaacacccag
gccttcaatgggaaaaatgacaatggcagcagtgactatgggatcttccagatcaacagc
aagtggtggtgcaaaaataactcctccccttcagcaaatgcctgcaacacaatgtgcagt
aggtttctggatgacaacatcagtgatgacatcacctgtgccaagagggttgtgaaagat
cctaatgggatgtctgcctgggtggcctgggtaagacactgcagatatctagccagttgt
aatctgtga

DBGET integrated database retrieval system