KEGG   Pelotomaculum thermopropionicum: PTH_0053Help
Entry
PTH_0053          CDS       T00519                                 

Gene name
RecR
Definition
recombinational DNA repair protein
Orthology
K06187  
recombination protein RecR
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pth00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PTH_0053 (RecR)
DNA repair and recombination proteins [BR:pth03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PTH_0053 (RecR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
55836..56438
Genome map
AA seq 200 aa AA seqDB search
MDYYAKPVARLIEQLARLPGIGPKTAQRLAFYLLNAPLEVALNLARAVEEARQAVRYCSV
CGNLTDTDPCFICGDDRRRRDLLCVVERPRDVVALEKARVFKGLYHVLHGSISPVEGIGP
EQLRIRELLKRLEGGTVREVILATNPTVEGETTALYLAGLIKPLGVSVTRIAHGLPVGAD
LEYADEMTLSKALEGRREMK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggactactacgccaaaccggttgcccgcctgatcgaacaattggccagactgcccggc
ataggccctaaaacggcgcagcgcctggctttttaccttttgaacgctcctctcgaggtt
gccctgaacctggcccgggccgttgaagaggcccggcaggccgtgcgctactgctcggtg
tgcggcaaccttaccgacaccgacccctgttttatctgcggggacgatcggcgcaggcga
gatttgctctgcgtggtcgagcgccccagggacgtggtggcgctggaaaaggcaagggtt
ttcaagggcctttatcacgtgctgcacggctccatttcgccggtggaggggataggcccg
gagcagcttagaataagggaactgctgaagcgccttgaggggggaacggtaagagaagtg
atcctggccaccaacccaaccgttgaaggggagactaccgccctttacctggccggtctg
atcaagccgctgggcgtcagcgtgaccagaattgcccacggcctgcccgtaggcgccgac
cttgaatacgccgacgaaatgacgctgagcaaggcgctggaaggcaggcgggaaatgaaa
tag

DBGET integrated database retrieval system