KEGG   Pelotomaculum thermopropionicum: PTH_0096Help
Entry
PTH_0096          CDS       T00519                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pth00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
90265..91128
Genome map
AA seq 287 aa AA seqDB search
MVITALARAKINLTLDVLGKRPDGYHEVEMVMQSIELHDRLEFRPCAAGGISLAVEGADL
PPGKENLVYRAAELLRAAGGVRAGAEIRLKKAIPVAAGLGGGSADAAAALVALNEMWNTG
FSPAGLMELAEQLGSDVPFGLMGGTALARGRGERLERLFPCPPLGLVLVKPPFGVSTAEV
YRAFKPGLNPKKADAQAMVRAIKKGDAADIAACLGNALEPVTVKMYPEVAEIKKKLMEAG
ALGALMAGSGPTVFGLTADLESARQVAARYRRTDEQILVTRTFNPRL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggtaataacggccctggccagggcgaaaattaaccttaccctggatgtgctggggaaa
aggcctgacggatatcacgaggtggaaatggtgatgcagtccatcgaactgcacgaccgc
ctggaattcaggccctgcgccgccggcgggatatccctcgccgtggaaggcgccgatctt
ccgccgggaaaggaaaatctggtttatcgcgccgcagagctgctccgggcggcgggcggg
gtcagggccggggcggaaatccggctgaaaaaggccattccggtggctgcagggctgggc
ggggggtcggcggacgctgcggctgcgctggtagccttaaatgaaatgtggaataccggc
ttttcaccggctgggctgatggaactggcggaacaactggggtcggatgtgccttttggc
ctcatgggcggcacggccctggcgcgcggccggggcgagcggcttgagcggctgtttccc
tgcccgccgctgggcctggttctggtaaagccgcctttcggcgtttccaccgcggaggtt
taccgcgcttttaagccgggcctaaatccgaaaaaagcggacgctcaggccatggtgaga
gcaataaaaaaaggggacgcggcggatattgccgcctgtcttggaaacgctctggagccc
gttaccgttaagatgtacccggaagtggcggaaataaagaaaaagctaatggaggccgga
gccctgggtgcccttatggccggcagcggccccaccgttttcgggcttacggcagacctg
gaatctgcccggcaggtggccgcccgctaccggaggacggacgaacagattctggttacc
cgcacttttaatccccggctctga

DBGET integrated database retrieval system