KEGG   Pelotomaculum thermopropionicum: PTH_0205Help
Entry
PTH_0205          CDS       T00519                                 

Gene name
FolK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PTH_0205 (FolK)
Enzymes [BR:pth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PTH_0205 (FolK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
205615..206106
Genome map
AA seq 163 aa AA seqDB search
MLRTAYIGLGSNMGDKKANIERALEMLKASAGVRVKRVASLYRTAPLGYTRQDWFLNTVA
EVETGLGPHELLALLLDIERRLGRVRTVRWGPRLIDLDLLVYGDEEIDTPALTVPHPRMG
ERAFVMVPLAELVPDLTVPGRGRAAELAEKLAGEQKICRFAVN
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcttaggactgcatatatcgggctgggcagcaacatgggcgacaagaaggccaatatc
gaaagggcgctggaaatgctgaaggcttccgccggcgtgcgggtgaagagagtggcgtcg
ctttaccggaccgccccgctgggctacacccggcaggactggtttctcaacaccgtggcc
gaggtggagaccggccttgggccgcacgaactgcttgccctcctgctggacatcgaaaga
aggctcgggcgggtgcgcaccgtccgctggggcccgcgcctgatcgaccttgacctgctt
gtttacggtgacgaggaaatagatactcctgccttgacggtcccgcatccccgcatgggc
gagcgcgcctttgtgatggtgccgctggccgaactggtgccggatttgaccgtgccgggc
cggggccgggcggcggaactggcggaaaaactggcgggagagcagaagatatgcagattt
gccgtaaattaa

DBGET integrated database retrieval system