KEGG   Pelotomaculum thermopropionicum: PTH_0270Help
Entry
PTH_0270          CDS       T00519                                 

Gene name
PaaJ
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Benzoate degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PTH_0270 (PaaJ)
   00630 Glyoxylate and dicarboxylate metabolism
    PTH_0270 (PaaJ)
   00640 Propanoate metabolism
    PTH_0270 (PaaJ)
   00650 Butanoate metabolism
    PTH_0270 (PaaJ)
  Lipid metabolism
   00071 Fatty acid degradation
    PTH_0270 (PaaJ)
   00072 Synthesis and degradation of ketone bodies
    PTH_0270 (PaaJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PTH_0270 (PaaJ)
   00310 Lysine degradation
    PTH_0270 (PaaJ)
   00380 Tryptophan metabolism
    PTH_0270 (PaaJ)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PTH_0270 (PaaJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PTH_0270 (PaaJ)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PTH_0270 (PaaJ)
Enzymes [BR:pth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PTH_0270 (PaaJ)
Exosome [BR:pth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PTH_0270 (PaaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
280576..281772
Genome map
AA seq 398 aa AA seqDB search
MANAVIVGGVRTAIGRIGGTLKNVQAEELAAHVIGEILKRTEVEGREVDEVILGQAKQSC
DAPNIARVSSLMAGLPIEVPAYTVHRQCGSGLQALINAAQQIRLDESGIIVAGGVESMST
APYYLRFARYGYGAGNGEILDPNTESQPRSQPESCYGRLTMGMTAENLAVKYSISRAEQD
EFALWSQEKAWAAIESGRFRPEITPFTVDSGKGKSTVFDTDEHPRKTSLEALSKLKPAFK
ENGTVTAGNSSGRNDGAAAVVMMAEEKARERGLFPYFRVVSYAASAVSPEIMGIGPVYAT
RRALDRAGLRLEDIDLIELNEAFAAQSLAVLRELQPDRERVNVNGGAIALGHPLGMSGAR
LVVTLIHEMVRRDSRYGLATLCIAGGQGLAMIVEKVKN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgctgttattgtgggaggagtgcgcactgccatcgggcgcatcgggggcacc
ttgaaaaatgtccaggcagaggagctggccgcccacgtaatcggtgaaatattgaaaaga
acggaagtggaagggagagaagttgacgaggtaattctgggccaggccaagcaaagctgt
gacgcccccaatattgcccgggtttcctctttgatggccggcctgcccattgaggtgccg
gcctacaccgtgcaccgccagtgcggttcaggtctgcaggccctgattaacgcagcccag
cagatcaggctggacgaatccgggataatcgtggcaggcggggtggagagcatgagcacc
gctccctattacctccgctttgcccgctacggctacggcgcgggaaacggcgaaatactt
gacccgaatacggaaagccagccccgctcgcagccggagagttgttacggccgtctgacc
atgggcatgaccgccgagaatctggccgttaaatacagcatcagccgcgccgagcaggac
gagtttgccctctggagccaggagaaggcctgggccgccattgaaagcggcaggttccgc
ccggaaattacgccttttaccgttgattcgggcaaagggaagagcacggttttcgatacg
gacgagcatccccgcaaaaccagcctggaggctttaagcaagcttaaaccggcttttaag
gagaacggcacggttaccgccggaaactcttccgggcggaacgacggggcagcggccgta
gtcatgatggcagaggaaaaggccagggaaagagggttattcccttatttccgggtggtt
tcctatgcggcatcggctgtcagcccggagataatgggcatcgggccggtttatgcaacc
cgcagggcgcttgacagggccggcctgcggctggaggatatcgacctgatcgagctgaac
gaggcttttgcggcgcagtcgctggcggtactaagggaactgcaacctgaccgggaacgg
gtcaatgtaaacggcggggcaattgccctcggccacccgctggggatgtcaggagcaagg
ctggtggttacgcttattcacgaaatggtccggcgggacagccgttacggcctggccact
ctttgcattgccggcggccagggcctggccatgattgtcgagaaggtaaaaaactga

DBGET integrated database retrieval system