KEGG   Pelotomaculum thermopropionicum: PTH_0293Help
Entry
PTH_0293          CDS       T00519                                 

Gene name
GlnS
Definition
glutamyl- and glutaminyl-tRNA synthetases
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:pth00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    PTH_0293 (GlnS)
Enzymes [BR:pth01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     PTH_0293 (GlnS)
Amino acid related enzymes [BR:pth01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   PTH_0293 (GlnS)
Transfer RNA biogenesis [BR:pth03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    PTH_0293 (GlnS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
300113..301555
Genome map
AA seq 480 aa AA seqDB search
MVRVRFAPSPTGPLHIGGARSALFNWLFARRYGGKFIVRIEDTDLERSSRQSEENILAAL
RWLGLDWDEGVDAGGPCEPYRQTERLHLYRHYAEILLQSGAAYRCYCTEEELAAEREALM
EKGETPRYLGRCRDLTPQERARLEAEGRKAAVRFRVPRDRVIQVKDLVRGDVSFECNGMG
DFIIMKSDGIPTYNFAVVVDDHTMAISHVIRAEEHLPNTPRQILLYQALGWDTPEFAHVS
LILGKDRSKMSKRHGATAVEQYREKGYLPEAVVNFLALLGWSPGGENEVLSIEELKQQFS
LEKVSKSPAVFDLDKLNWLNGYYIRQSSLERVAELAVPFLEKAGYIRAPLSPEEFERVKM
MVASVRKYLNCMEEVIDHVKIYFTDNFNNLDEDAREVMAGQQVPAVLAALKDKVASGGKL
TGAAARAALKEVGKELGVKGQQIFMPVRVAVSGNTHGPDLDQIMAILGKDEVVKRLSRWV
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggttagagtgaggtttgcgcccagtcctacgggcccgctgcatattggcggggccagg
tcggcgctgttcaactggctttttgcccgccgctacggcggtaaatttattgtgcgcatt
gaggataccgacctggagcggtcgtcccgccagtcggaggagaatattctggccgcgctg
cgctggctcggcctggactgggacgaaggggttgatgcgggcgggccctgtgagccttac
cgccagacggaaaggctgcatctctaccggcactacgcggaaattctcctgcaaagcggg
gctgcctaccgttgctactgcaccgaagaagaactggcggcggaaagggaggccctcatg
gaaaagggtgaaacgccccgctatctgggccggtgccgcgaccttaccccgcaggaacgc
gcccgcctggaggccgaaggccggaaggcagcggtgcggttccgggtgcccagggacagg
gtaatccaggtgaaagacctggtgcggggcgacgtttcctttgaatgcaacgggatgggc
gactttatcattatgaaatcggacggaatccccacatataattttgcggtggtcgtcgac
gaccataccatggcgataagccatgtgatcagggcggaggagcacctgcccaacaccccg
cggcagattcttttgtaccaggccctggggtgggataccccggaattcgcccacgtgtcc
ctgatcctgggcaaggaccggagcaagatgagcaagcggcacggcgccaccgccgtcgag
cagtaccgggaaaaaggctacctgcccgaggccgtggtcaacttcctggcccttttgggc
tggtcgccgggaggagagaacgaggtcctttccatagaagagctgaagcagcagttctcc
ctggaaaaggtttcaaaaagcccggccgtctttgatctggacaaacttaactggctgaac
ggctactacatcaggcagtcttccctggagagggttgccgagttggccgtgccgtttctg
gaaaaggccggctacattagggcaccgctttccccggaagagtttgagcgggtcaagatg
atggtggcatccgtccggaagtacctgaattgcatggaagaagttatcgatcacgttaaa
atctactttaccgataattttaataaccttgatgaagatgccagggaagtcatggccggg
cagcaggttccggcggtgcttgcggcccttaaggacaaagtggcgtccggcgggaagctg
accggggcggccgccagggcggcgcttaaggaagtgggcaaagaactgggcgttaagggc
cagcagatttttatgccggtaagggtagccgtttcgggaaacacccacgggcccgatctg
gaccagatcatggccattcttgggaaggacgaggtggtcaagcgcctctcgaggtgggtc
tga

DBGET integrated database retrieval system