KEGG   Pelotomaculum thermopropionicum: PTH_0398Help
Entry
PTH_0398          CDS       T00519                                 

Gene name
ManB
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pth00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pth00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pth00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pth00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pth00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pth00520]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pth00230]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pth00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
383115..384386
Genome map
AA seq 423 aa AA seqDB search
MREHGGSEVIIGRDNRVSSARLRDDLVRGLVAAGCRVVDVGLVVTPMVYFARIHFGIDGA
VMITGSHNPPEENGFKISRGAGTIYGEEIQRLRALMEKGKFAEGNGAVEERDVAASYLAM
LREKIKLGPRRLKVAVDCGNGTASLFAEQLLEGWGCEVVPLYCEPDGSFPNHQPDPVKTA
NLADLRKAVLESGADLGVAYDGDADRIGVVDEKGNIVWGDRLMCLYWREILPRFPGAAAI
IEVKCSQALVDEVARLGGRPFFYKTGHSLIKAKMKEVGAVFTGEMSGHMFFADEYFGYDD
AFYATGRLLRILSGAEEPLSRLLESVPQYYSTAETRVPCADREKFRVVAGLVEHFRQRYE
VIDVDGARVLFGDGWGLVRASNTQPVLVARCEAKTQEGLDRICGIMKEALREYPAVGAFE
WEF
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggagcacggcggcagtgaggtgattataggccgggacaaccgggtgagttctgcg
aggctgcgggacgacctggtgcgggggctggtggccgcgggctgccgggtggttgacgtg
gggctggtggtcacgcccatggtgtactttgcccgcatccatttcggcattgacggggcc
gtgatgattaccggcagccacaacccgccggaggaaaacgggtttaaaatttcccgcggc
gccgggacgatttacggtgaagaaatacagcgcttgagggcgctgatggaaaagggtaaa
tttgcagagggcaacggcgcggtggaagagcgggacgtggccgcatcctacctggccatg
ctgcgggaaaagatcaagctgggcccgcgccggctgaaagtggcggtggactgcgggaac
gggacggcttcccttttcgcggagcagttgctcgaaggctggggctgcgaggtggtgccg
ctgtactgcgagcctgacggctcttttcccaaccaccagccggacccggtgaaaaccgcc
aacctggcggatttaaggaaggccgtgctggaaagcggtgccgacctgggggtggcctac
gacggcgacgccgaccgcatcggtgtggtggatgaaaaagggaatatcgtctggggcgac
aggctgatgtgcctgtactggcgggaaatactgccgcgttttcccggggcggcggcgatc
atagaggtgaagtgctcccaggcgctggtggacgaggtggcccggctgggaggcaggccg
tttttttacaagaccggccactccctgatcaaggccaaaatgaaggaagtgggggcggtg
ttcaccggcgaaatgtcggggcacatgttctttgccgatgagtacttcgggtacgacgac
gccttttacgccaccgggcgcctgctgcgcatcctgtccggcgcggaagagcccctctcc
aggctgctggagagcgtgccgcagtattattccacggcggagacccgggtgccctgcgcc
gaccgggagaagtttcgcgtcgtggccgggctggtggagcatttccggcagcgctatgaa
gtgatagacgtggacggcgcccgggtgctgttcggcgacggctggggcctggtgcgggcc
tccaacacccagccggtgctggtggcccgctgcgaggctaaaacacaagaaggattggac
cgcatttgcggcatcatgaaggaagcgctgcgggagtacccggcagtgggggcctttgag
tgggaattttaa

DBGET integrated database retrieval system