KEGG   Pelotomaculum thermopropionicum: PTH_0398Help
Entry
PTH_0398          CDS       T00519                                 

Gene name
ManB
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTH_0398 (ManB)
   00030 Pentose phosphate pathway
    PTH_0398 (ManB)
   00051 Fructose and mannose metabolism
    PTH_0398 (ManB)
   00052 Galactose metabolism
    PTH_0398 (ManB)
   00500 Starch and sucrose metabolism
    PTH_0398 (ManB)
   00520 Amino sugar and nucleotide sugar metabolism
    PTH_0398 (ManB)
  Nucleotide metabolism
   00230 Purine metabolism
    PTH_0398 (ManB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PTH_0398 (ManB)
Enzymes [BR:pth01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PTH_0398 (ManB)
    5.4.2.8  phosphomannomutase
     PTH_0398 (ManB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
383115..384386
Genome map
AA seq 423 aa AA seqDB search
MREHGGSEVIIGRDNRVSSARLRDDLVRGLVAAGCRVVDVGLVVTPMVYFARIHFGIDGA
VMITGSHNPPEENGFKISRGAGTIYGEEIQRLRALMEKGKFAEGNGAVEERDVAASYLAM
LREKIKLGPRRLKVAVDCGNGTASLFAEQLLEGWGCEVVPLYCEPDGSFPNHQPDPVKTA
NLADLRKAVLESGADLGVAYDGDADRIGVVDEKGNIVWGDRLMCLYWREILPRFPGAAAI
IEVKCSQALVDEVARLGGRPFFYKTGHSLIKAKMKEVGAVFTGEMSGHMFFADEYFGYDD
AFYATGRLLRILSGAEEPLSRLLESVPQYYSTAETRVPCADREKFRVVAGLVEHFRQRYE
VIDVDGARVLFGDGWGLVRASNTQPVLVARCEAKTQEGLDRICGIMKEALREYPAVGAFE
WEF
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggagcacggcggcagtgaggtgattataggccgggacaaccgggtgagttctgcg
aggctgcgggacgacctggtgcgggggctggtggccgcgggctgccgggtggttgacgtg
gggctggtggtcacgcccatggtgtactttgcccgcatccatttcggcattgacggggcc
gtgatgattaccggcagccacaacccgccggaggaaaacgggtttaaaatttcccgcggc
gccgggacgatttacggtgaagaaatacagcgcttgagggcgctgatggaaaagggtaaa
tttgcagagggcaacggcgcggtggaagagcgggacgtggccgcatcctacctggccatg
ctgcgggaaaagatcaagctgggcccgcgccggctgaaagtggcggtggactgcgggaac
gggacggcttcccttttcgcggagcagttgctcgaaggctggggctgcgaggtggtgccg
ctgtactgcgagcctgacggctcttttcccaaccaccagccggacccggtgaaaaccgcc
aacctggcggatttaaggaaggccgtgctggaaagcggtgccgacctgggggtggcctac
gacggcgacgccgaccgcatcggtgtggtggatgaaaaagggaatatcgtctggggcgac
aggctgatgtgcctgtactggcgggaaatactgccgcgttttcccggggcggcggcgatc
atagaggtgaagtgctcccaggcgctggtggacgaggtggcccggctgggaggcaggccg
tttttttacaagaccggccactccctgatcaaggccaaaatgaaggaagtgggggcggtg
ttcaccggcgaaatgtcggggcacatgttctttgccgatgagtacttcgggtacgacgac
gccttttacgccaccgggcgcctgctgcgcatcctgtccggcgcggaagagcccctctcc
aggctgctggagagcgtgccgcagtattattccacggcggagacccgggtgccctgcgcc
gaccgggagaagtttcgcgtcgtggccgggctggtggagcatttccggcagcgctatgaa
gtgatagacgtggacggcgcccgggtgctgttcggcgacggctggggcctggtgcgggcc
tccaacacccagccggtgctggtggcccgctgcgaggctaaaacacaagaaggattggac
cgcatttgcggcatcatgaaggaagcgctgcgggagtacccggcagtgggggcctttgag
tgggaattttaa

DBGET integrated database retrieval system