KEGG   Pelotomaculum thermopropionicum: PTH_0482Help
Entry
PTH_0482          CDS       T00519                                 

Gene name
MhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PTH_0482 (MhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PTH_0482 (MhpF)
   00650 Butanoate metabolism
    PTH_0482 (MhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    PTH_0482 (MhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PTH_0482 (MhpF)
   00622 Xylene degradation
    PTH_0482 (MhpF)
   00621 Dioxin degradation
    PTH_0482 (MhpF)
Enzymes [BR:pth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PTH_0482 (MhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
464623..465519
Genome map
AA seq 298 aa AA seqDB search
MKKVKAAIIGPGNIGTDLMYKLLRSNYIEIALMVGIYPQSEGLARARSLGIETSHEGIGA
VLREPDIKIVFDATAAKPHLKHAPLLREAGKIAIDLTPAAVGPYMVPVVNIDEHLEADNV
NMVTCGGQATVPIVAAINRVAGVRYAEIVASLASKSAGPGTRQNIDEFTETTARALEVVG
GAGKGKAIIILNPAEPPIMMHNTIYTLVENPDEELIKSAVFEMVKRIQEYVPGYRLQVEP
LVEGNKVTTIIEVTGAGDYLPPYAGNLDIMTSAAARAGELMAMRLLGVYKPERGDSCA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagttaaggcagccattatcggaccgggcaacatcggcaccgacttaatgtac
aagctcttgcgcagcaactacatagagatagccttgatggttgggatttaccctcagtcg
gaagggctggccagggccaggtcgctggggattgagacttcacatgaaggaatcggtgcg
gttttaagggagccggacataaaaatagtttttgacgcaacggcggccaaacctcacctt
aaacacgcacctttgctgcgcgaggcgggcaagattgccatcgatctcactcctgcggcg
gtgggaccttacatggtgccggttgtcaatattgatgaacacctggaagccgataacgtg
aacatggttacctgcggcggccaggctaccgtaccgattgtggctgccatcaaccgggtg
gccggggtgcgctacgcagaaattgtcgcctcgctggccagcaaaagcgcggggcccgga
acccgccagaatatcgacgagtttaccgagaccacggcaagggccctggaggtggtggga
ggcgccggcaaaggtaaagcaatcatcattcttaatccggccgagcccccgatcatgatg
cacaacactatttacactctggtcgagaacccggatgaagaattaattaaaagcgccgtt
tttgagatggtaaagcgcattcaggaatacgtgccggggtaccgcctgcaggtggagccc
ctggtagaaggaaacaaggtaactacaatcatagaggtgaccggcgccggggactacctg
ccgccttacgcaggcaacctggacattatgacttcggccgccgccagggcgggagaattg
atggccatgcggctgctgggcgtttataagccggagaggggtgatagctgtgcctga

DBGET integrated database retrieval system