KEGG   Pelotomaculum thermopropionicum: PTH_0482Help
Entry
PTH_0482          CDS       T00519                                 

Gene name
MhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pth00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pth00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:pth00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:pth00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:pth00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
464623..465519
Genome map
AA seq 298 aa AA seqDB search
MKKVKAAIIGPGNIGTDLMYKLLRSNYIEIALMVGIYPQSEGLARARSLGIETSHEGIGA
VLREPDIKIVFDATAAKPHLKHAPLLREAGKIAIDLTPAAVGPYMVPVVNIDEHLEADNV
NMVTCGGQATVPIVAAINRVAGVRYAEIVASLASKSAGPGTRQNIDEFTETTARALEVVG
GAGKGKAIIILNPAEPPIMMHNTIYTLVENPDEELIKSAVFEMVKRIQEYVPGYRLQVEP
LVEGNKVTTIIEVTGAGDYLPPYAGNLDIMTSAAARAGELMAMRLLGVYKPERGDSCA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagttaaggcagccattatcggaccgggcaacatcggcaccgacttaatgtac
aagctcttgcgcagcaactacatagagatagccttgatggttgggatttaccctcagtcg
gaagggctggccagggccaggtcgctggggattgagacttcacatgaaggaatcggtgcg
gttttaagggagccggacataaaaatagtttttgacgcaacggcggccaaacctcacctt
aaacacgcacctttgctgcgcgaggcgggcaagattgccatcgatctcactcctgcggcg
gtgggaccttacatggtgccggttgtcaatattgatgaacacctggaagccgataacgtg
aacatggttacctgcggcggccaggctaccgtaccgattgtggctgccatcaaccgggtg
gccggggtgcgctacgcagaaattgtcgcctcgctggccagcaaaagcgcggggcccgga
acccgccagaatatcgacgagtttaccgagaccacggcaagggccctggaggtggtggga
ggcgccggcaaaggtaaagcaatcatcattcttaatccggccgagcccccgatcatgatg
cacaacactatttacactctggtcgagaacccggatgaagaattaattaaaagcgccgtt
tttgagatggtaaagcgcattcaggaatacgtgccggggtaccgcctgcaggtggagccc
ctggtagaaggaaacaaggtaactacaatcatagaggtgaccggcgccggggactacctg
ccgccttacgcaggcaacctggacattatgacttcggccgccgccagggcgggagaattg
atggccatgcggctgctgggcgtttataagccggagaggggtgatagctgtgcctga

DBGET integrated database retrieval system