KEGG   Pelotomaculum thermopropionicum: PTH_0608Help
Entry
PTH_0608          CDS       T00519                                 

Definition
(GenBank) predicted alternative tryptophan synthase beta-subunit
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PTH_0608
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PTH_0608
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PTH_0608
Enzymes [BR:pth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PTH_0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
599198..600553
Genome map
AA seq 451 aa AA seqDB search
MSDTKILLKEKEMPEAWYNIQADMPNLPKPPLHPVTKEPVGPQDLKPIFPMGLIEQEVSR
DRWIEIPDEVREIYRLWRPSPLCRARRLEKALDTPAHIYYKYEGVSPAGSHKLNTSVPQA
YYNKKEGIKRLATETGAGQWGVALSQACSFFGLECTVYMVKVSYHQKPYRRSLMQVFGSN
VIPSPSELTSSGRKILEKDPDSLGSLGIAISEAVEDAAGREDTNYALGSVLNHVILHQTV
IGLEAKKQMEKADHYPDVVIACCGGGSNFGGMAFPFAHDKLVKGKKVRLLAVEPISCPTL
TRGHFGYDYGDVAGFTPLLWMYTLGKDFMPPGIHAGGLRYHGDSPLVSQLVHDGIVEARA
YGQTAVFQSAVLFARSEGVLPAPESSHAIHAAVEEALAAKEAGEKRIILFNLSGHGLLDL
SSYDAYLEGKLIDYPLPEEELEKALAALPKV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacactaaaattttgttgaaagaaaaagagatgccggaggcgtggtacaatatc
caggcagatatgccaaatttgccaaagcctcccctgcacccggtcaccaaagagccggtc
ggcccgcaggaccttaagccaattttcccgatggggttgattgagcaagaagtgagccgg
gatcgctggatcgaaattccggacgaggtgcgggagatttaccgcctctggaggccgtcg
cctttgtgcagggcccgccgcctggagaaggcgcttgacacgcccgcgcacatctactac
aagtacgaaggggtaagcccggccggcagccataagctgaacacgtccgtaccccaggct
tattataataaaaaagaaggcataaagaggctggctaccgagaccggcgccggccagtgg
ggcgtagcgctttctcaggcctgcagcttttttggcctggagtgcactgtctacatggtg
aaggtaagctaccaccaaaagccataccggcgctcgctgatgcaggttttcggctcaaac
gtgattcctagccctagcgaactgaccagctcgggccggaagattttagaaaaagatccg
gattcactgggcagcctcggcattgccatcagcgaggcggtggaggacgcagccgggcgc
gaagataccaactacgccctgggcagcgttttaaaccacgttatcctgcaccagaccgtc
attggtcttgaagcgaaaaagcaaatggagaaggccgaccactacccggacgtagtaatt
gcctgctgcggcggcggcagcaacttcggcgggatggccttcccctttgcccacgacaag
cttgtcaagggcaaaaaagtgcgcctgttggcggtggagcccatttcctgcccgaccctc
acgcgcggccatttcggctatgactacggcgacgtggcgggattcaccccgctgttgtgg
atgtacaccctgggcaaggatttcatgccgccgggcatccatgccggcgggctgcgttac
cacggcgactcccccctggtgagccagcttgttcacgacggtattgtagaagcgcgcgcc
tacgggcagacggcggtctttcaatcagccgtgctttttgccagaagtgaaggggtcctg
ccggcgcccgagtcctcccacgccatccacgccgccgttgaagaggccctggcagcaaag
gaagcgggcgaaaagcggatcatcctgttcaacttgagcgggcacggccttttagacctg
tcctcgtatgacgcctacctggagggtaagttaatagactacccgctgccggaggaagag
ctggagaaggccctggcggcccttccaaaggtttaa

DBGET integrated database retrieval system