KEGG   Pelotomaculum thermopropionicum: PTH_0673Help
Entry
PTH_0673          CDS       T00519                                 

Gene name
AsnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PTH_0673 (AsnB)
Enzymes [BR:pth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PTH_0673 (AsnB)
Peptidases [BR:pth01002]
 Cysteine Peptidases
  Family C44
   PTH_0673 (AsnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
662098..663945
Genome map
AA seq 615 aa AA seqDB search
MCGITGWINWEADLTRQGHILEKMVETLSRRGPDAAGVWLSPRAAVGHRRLIVVDPEGGS
QPMTRRLGERACTITYNGELYNAPELRRELESRGHRFYTRNSDTEALLLAYMEWGTACVE
RLNGIFAFAVWDEAGQSLFLARDRLGVKPLFYAVRGSSFLFGSELKALLAHPAVKPEVDE
EGLAEVFAVGPSRTPGHAVYRGIAELRPGCCLVFARNGLRLRRYWALESHPHPDDFETTV
ATVRELFMDAVERQLVSDVPVCTFLSGGLDSSAIAAVAAGAFRRKGLGKLRTYSVDYTGN
DRFFRPDYFQPNSDAWWTGRVADCLGTSHHVVEIDTPELIEALVPALLANDLPGMADIDS
SLYLFCREIKKGATVALSGESADEVFGGYPWFYDEEALAAGTFPWIRKLRERVQFLSPEL
AGRIKPEEYVAERYQEALAEVPRLPGETPFEARLREMFYLNITRFMQMLLDRKDRMSMAA
GLEVRVPFCDHRLVEYVWNIPWEMKSCDGMAKGILRRALSGILPEEVLRRRKSPYPKTHN
PAYLAAVRSLVLRLLDDPGSPLLPLINVEAVREAALSGSALFDRPWFSQLMGDAQFFAYL
IQVDAWLRNYGVTIR
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatcaccggctggataaactgggaagcggacctgacccggcagggtcacatc
ctggaaaagatggttgaaacgctgtcccgccgggggcctgacgccgccggggtctggctg
tcgccccgcgccgccgtcgggcaccgccggctgattgtcgttgaccccgaaggcgggagc
cagcccatgacccgccggctgggggagcgcgcctgcaccataacctacaacggcgaactg
tataatgcgccggaattaaggcgggaactggaatcgcgcgggcaccggttctacacccgc
aattccgacaccgaagcgcttcttttagcctatatggaatgggggacggcctgcgtggaa
cgcttaaacggcatttttgcctttgccgtctgggacgaggccggccagagcctgttttta
gcccgcgaccgcctgggggtgaagccccttttttacgcggtgagaggcagttcctttctg
ttcggttcagagctgaaggcgcttctggcccatccggcggtgaagccggaggtggatgag
gaggggctggccgaagtgtttgccgtcggcccgtcgcgcacgccggggcacgcggtttac
cgcggaattgcagagctgaggccggggtgctgccttgtgtttgcccggaacggcctgcgc
ctgcgccgctactgggctctggagagccatccccaccccgatgactttgagaccaccgtt
gccacggtgcgggagctttttatggatgccgtcgagcggcaactggtatccgacgtgccg
gtctgcaccttcctgtccggcgggctggactccagcgcaattgccgccgttgccgcaggc
gccttccggcggaaagggctgggaaagctccgcacttactccgtcgactataccgggaac
gaccgctttttccggccggattatttccagcccaactccgacgcctggtggacggggcgg
gtggcggactgcctcggcacaagccatcatgtagttgaaattgacacccccgaactgatt
gaagcgctggtgccggcgttactggccaacgacctgcccggtatggcggatatagactcc
tccctttaccttttctgccgcgagataaaaaagggcgctactgtcgccctttccggggag
tcggccgacgaggtgttcggcggctatccctggttttacgatgaggaagctttggctgcc
ggcacctttccctggatcagaaagctgcgggaacgggtgcagtttctttcgcctgagctg
gccgggcggataaagccggaggagtatgtggccgaacgctaccaggaggccctggccgag
gtgccgcggctgcccggcgaaaccccttttgaggcgcgccttagggaaatgttttacctg
aacatcacgcggtttatgcagatgcttttggaccggaaggaccggatgagcatggcggcc
ggcctggaggtgcgggtgccgttctgcgaccaccgcctggtggagtatgtctggaacatc
ccgtgggaaatgaaaagctgtgacggcatggctaaaggcattctgcgccgggcgctttcc
ggcatacttccagaggaggtgctgcggcggaggaaaagcccttacccgaagactcataat
ccggcctacctggcggcggtgcgcagcctggtgctgcgcctccttgacgatccggggtcg
cccctgctgccgctgatcaacgtggaggccgttcgcgaggcggccctctccggcagtgcc
ctttttgaccggccctggttcagccagctaatgggtgacgcccagttttttgcctatctc
atccaggtggatgcctggctaagaaattacggtgttaccatcaggtaa

DBGET integrated database retrieval system