KEGG   Pelotomaculum thermopropionicum: PTH_0834Help
Entry
PTH_0834          CDS       T00519                                 

Gene name
ProB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PTH_0834 (ProB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PTH_0834 (ProB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PTH_0834 (ProB)
Enzymes [BR:pth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PTH_0834 (ProB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
841167..842297
Genome map
AA seq 376 aa AA seqDB search
MDTEKRCFKDFKRMVVKVGSSSVAHPTGKPNLFQIENLVRQLADLHNQGKEVILVTSGAV
GTGTGKLGLAARPRTIPEKQAAAAVGQGVLMHIYEKFFGEYGVTVGQVLLTRQDFSDRRR
FLNARNALHALFQFGVIPVINENDTIAVDEIKFGDNDSLSALVAGLVDAELLILLSDIDG
LYTADPRKDPGARLIQDVKEITPEIESLAGGTGSKLGTGGMATKLQAARMAMHSGVVTVI
ARAGEKDVIRQIIAGEQVGTIFWPSANKLENKKRWIAYSSAVCGKVFVDEGAARALLKQG
KSLLPSGVTGVEGNFDMGNTVSIIGPDGREIARGLTYYSSVEIERIKGAQTRDIARILGY
KDYDEIVHRNNLVLSL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggacacggaaaagcgctgttttaaagattttaagcggatggtggtaaaggtaggctcc
agttctgttgcccaccctaccggcaagccaaatctctttcaaattgaaaatctggtgcgg
caactggccgacctgcataaccagggcaaggaggtcatcctggttacttcgggcgccgtc
ggcacgggaaccggcaagctgggcctggcggcccgcccgcggaccattcccgagaaacag
gccgccgcagcagttggccagggcgtgctgatgcacatttatgaaaagtttttcggcgag
tacggggttacggtgggccaggtgcttctgacgcgccaggacttttccgaccggcgccgc
tttttgaatgccaggaatgccctgcacgccctgtttcaatttggtgtgattccggtaatt
aacgagaacgataccattgccgtcgacgaaataaaattcggcgacaacgacagcctttcg
gccctggtggctggcctggtggacgcagagcttttaatcctgctttccgacatcgacggg
ctttacacggccgatccgcgcaaggaccccggcgcccggctgattcaggacgttaaggag
attaccccggaaattgaatcccttgccgggggcacaggcagcaaactcggaacgggcggc
atggccaccaagctgcaggcggccaggatggccatgcattccggtgtggtgacggtaatt
gccagggcaggggaaaaagacgtgatccggcaaataattgccggcgagcaggtcgggacg
attttctggccgtccgccaacaagctggaaaacaaaaaaaggtggatagcttacagctct
gccgtatgcggcaaggtcttcgtcgacgagggggcggcgcgcgccctgctcaagcagggg
aaaagcctgcttccgtccggcgtcaccggggtggagggcaactttgacatgggcaacacg
gtgagcattatcggcccagacggcagggaaatagccagggggctgacctattactcctct
gttgaaatagaacggatcaaaggggcccagacgcgtgacattgcccggatcctgggttat
aaggattacgacgagatagtgcacaggaacaacctggtgctgagcctgtag

DBGET integrated database retrieval system