KEGG   Pelotomaculum thermopropionicum: PTH_0921Help
Entry
PTH_0921          CDS       T00519                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pth01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pth00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(939016..940809)
Genome map
AA seq 597 aa AA seqDB search
MELFCWCGKALRVNLSSGVIKEENIGQEVLKTWLGGRGLGARMVAAEVPAGCDPLGEENK
IIFAAGPLTGTKVPGTGRFSASAKSPLTGTIFDSNAGGRWGVELKRCGYDALIIEGKANA
PACLTITGGRARLEEAGELWGAGVAETNRKLAEKLGKVISTACIGPAGENLVKFAAILCD
GHRALGRGGLGAVMGAKRLKAITLHGTGTVRVASPDKLNFMNYEAGKWIKANPITSKGLP
EFGTPVLVNLFNEMGVLPTRNFQFSRFAGALKISGEAITETMFAGRRGCYGCPVQCAMLV
KTSTGITAGPEYESVWALGPQCGIDDLEVIVEANRLCNDLGLDTISTGVTIGCAMELAEK
GFLKEGLNFGDGPGLLSAIRRIAFREGTGNLMAEGSRYLAGNCMAPGYAMQAKGLELPAY
DPRGLQGMGLALATSNRGGCHLRAYMAGPEALGVPKMVNRFSTEGKAGLAINQQNIGAAA
DSLAVCRFINLAVTEEYFARILSAATGVDYRPQDLYRAGERIWNLERLYNLKAGLDSSCD
TLPPRLLEEPVPDGPSRGKTVVLKPMLEEYYRFRGWDRAGRPTRKKIQELQLEEFSC
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggaacttttctgctggtgcggcaaggccctccgggtaaatttgagcagcggagttata
aaagaggaaaatatcgggcaagaggttcttaagacctggcttgggggacgcgggctgggc
gccaggatggttgccgccgaagtgcccgccgggtgcgaccctctgggggaagaaaacaag
attatttttgccgccgggccccttaccggcaccaaggtgcccggcaccgggcgcttcagc
gcctcggccaaatccccccttaccggcaccattttcgattcgaacgccggaggaaggtgg
ggcgtcgaactaaaaaggtgcggctatgacgcgctcattatagaaggaaaggcaaatgcg
ccggcttgcctgacaataaccggcggccgggcacgcctggaagaggccggcgaactctgg
ggcgccggcgttgccgaaacaaaccggaagcttgccgaaaagctcggcaaagtgataagc
acggcctgcatcgggccggccggggaaaacctggtcaagtttgccgcaatcttgtgcgac
ggtcaccgcgccctgggccggggcgggctgggggcagtaatgggcgccaagcggcttaag
gccattaccctgcacggaaccggcacggtaagggtggccagcccggacaaactgaatttt
atgaattacgaggccggcaaatggatcaaggccaaccccatcacctccaaagggctgccc
gaattcggcaccccggtcctggtaaacctatttaatgagatgggggtgctcccaacccgc
aacttccagttttcccggtttgccggcgccctgaaaatttcaggcgaggccattaccgaa
accatgtttgccgggcgcaggggctgctacggctgcccggttcagtgcgccatgctggtc
aaaaccagcaccggaatcactgccgggcccgaatatgaatccgtatgggcgctgggcccg
caatgcggcatagacgacctggaagttatagtggaggcaaaccggctctgcaacgacctc
ggcctggacaccatatccaccggggtaaccatcggctgtgccatggagcttgcagaaaaa
gggtttttaaaggaggggctcaacttcggcgacgggccgggcctgctctccgccatcagg
cggatagccttccgggaaggaaccggcaatttgatggccgaaggatcgcggtacctggcc
ggcaactgcatggctcccggctacgccatgcaggcaaagggactggaactgcccgcctac
gatccccgcggcctgcagggcatgggcctggcacttgccacctccaacaggggagggtgc
cacttaagggcctacatggccggcccggaggctcttggcgtgccgaaaatggtaaaccgg
ttcagtaccgaaggaaaagccggcctggccatcaaccagcaaaacatcggggcggccgcc
gacagcctggcagtctgccgctttatcaacctggccgtaacggaggaatacttcgccaga
attctgtccgcggccaccggcgtggactaccggccgcaggacctttaccgggccggcgag
cggatctggaacctggaaaggctgtacaacctcaaagcagggctggactcttcctgtgat
accctgccgcccaggctactggaggaacccgttccggacggcccgtcccggggcaagacg
gtcgtgttaaagcccatgctggaagaatattaccggttcagggggtgggatcgggccgga
cggcccacccggaaaaaaattcaggaactgcaactggaggaattttcatgctaa

DBGET integrated database retrieval system