KEGG   Pelotomaculum thermopropionicum: PTH_0932Help
Entry
PTH_0932          CDS       T00519                                 

Definition
fructose 1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTH_0932
   01230 Biosynthesis of amino acids
    PTH_0932
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTH_0932
   00030 Pentose phosphate pathway
    PTH_0932
   00051 Fructose and mannose metabolism
    PTH_0932
  Energy metabolism
   00680 Methane metabolism
    PTH_0932
Enzymes [BR:pth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     PTH_0932
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     PTH_0932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(952338..953432)
Genome map
AA seq 364 aa AA seqDB search
MGSKVTVSVIKADIGGFVGHSSVHPELLETARGILAGSPLLIDFHVTHVGDDINLIMTHD
GGKDNGEIHQLAWETFSSCTKIAKKMKLYGAGQDLLADAFSGNIKGLGPGLAEMEFEERN
SEPIIVFMADKTEPGAWNLPLYKMFADPFNTIGLVIDPKMHKGFLFEVHDLIENKKITFS
CPEELYDMLVFIGAPGRYCIKSVYHKETGEIAATSSTQRLNLMAGRYVGKDDPVLIVRCQ
SGFPAVGEALEPFANPHLVSGWMRGSHSGPLMPVSVAQSNPTRFDGPPRVVALGFQLSDG
KLHGPQDFFADPSYDLARQKANEIASYMRSMGPFEPHRLHLEEMEYTTMPEVSKRIKDRF
EKLR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtaaagtaacagtatcagtcattaaagccgacattggcgggtttgtaggccat
tccagcgttcacccggagctgctggaaaccgccaggggtattttagccggaagtccgctt
ctcatagacttccacgtcacccacgtcggcgacgacatcaacctgatcatgacacacgac
ggaggcaaggacaacggcgaaatacaccagttagcctgggaaaccttctcatcctgcacc
aaaattgccaaaaagatgaaattatacggcgcgggacaggatctgctggccgacgctttt
tccggaaatatcaagggcctcgggcccggcctggccgaaatggagtttgaggagcgcaat
agcgagccgataatcgtcttcatggccgacaaaaccgagccgggcgcctggaacttaccg
ctttataaaatgtttgccgatcctttcaacaccatcggcctggttatcgaccccaaaatg
cacaaagggtttttatttgaggtacacgacctgattgaaaacaaaaaaattaccttttcc
tgccccgaagagctttatgatatgctcgtgtttatcggcgcccccggccgatattgcatc
aagtcggtttaccacaaggaaaccggtgaaattgccgccacctcaagcacccagcggctg
aacctgatggccgggcgctatgtgggcaaagacgacccggttttaatagtgcgctgccag
agcggcttcccggcggtgggggaagcgctggagccctttgccaacccccacctggtgtcg
ggctggatgcggggttcccacagcggcccgctgatgccggtgtccgtagcccagtccaac
cccacccgttttgacggcccgcccagggtggtggcgctcggcttccagctaagcgacggc
aagctgcacggaccacaggacttctttgccgatccctcctacgacctggccaggcaaaag
gccaacgagattgccagctacatgcgcagcatggggccctttgagccgcaccgcctgcac
ctggaagaaatggagtacaccaccatgccggaagtcagcaagcgcattaaagatcgcttc
gaaaagcttcgctag

DBGET integrated database retrieval system