KEGG   Pelotomaculum thermopropionicum: PTH_0975Help
Entry
PTH_0975          CDS       T00519                                 

Gene name
HemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PTH_0975 (HemB)
Enzymes [BR:pth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PTH_0975 (HemB)
Exosome [BR:pth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PTH_0975 (HemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1000960..1001943
Genome map
AA seq 327 aa AA seqDB search
MAFPVNRPRRLRKNENLRRLVREARLSVDDLVYPVFVTHGRGVARPVESMPGICNYSIDR
LLEELEEVAALNIPAVLPFGVPEAKDELGSGAYAEDGIIQQAVRAIKEAYPGLLVITDIC
LCEYTSHGHCGVVENGQVLNDPTLDLLARTAVSHARAGADMVAPSDMMDGRVGAIRRALD
ENGFADVPIMAYSAKYASAFYGPFREAAGSAPQFGDRKAYQMDPANSDEALREVWLDIEE
GADIVMVKPALAYMDVIRRVKDDYGYPVAAYNVSGEYSMVKAAAQRGWVDEQRIVMEILT
GLKRAGADIIITYHAKDAARWLREGRQ
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcctttccggttaaccggccaaggcgcttgagaaaaaatgaaaatttgcggaggctg
gtgcgtgaggccaggctttccgtggacgacctggtctaccccgtttttgttacccacggc
aggggggttgccaggcctgttgagtccatgcccggcatttgcaactattcaatagacagg
ctgcttgaagaactggaggaagtggccgcgctgaacatacccgccgtgctgcctttcggc
gtgccggaggcaaaagatgaactggggtccggggcttatgccgaagacggcatcatccag
caggcggtgcgggcaattaaggaggcctaccccgggctgctcgtaattaccgacatttgc
ctttgcgagtacaccagccacggccactgcggagtggtcgaaaacgggcaggtcttgaac
gaccccaccctggacctgcttgcgcgcacggccgtttcccacgccagggcgggcgcggac
atggtggcgccgtcggacatgatggacggcagggtgggggccatccgcagggcgctggac
gaaaacggttttgcggacgtacccataatggcctactcggccaagtacgcctcggccttt
tacgggccgttccgggaggcggccggatccgccccgcagttcggcgacaggaaggcttac
cagatggacccggccaattccgatgaggcgctccgggaggtctggctagacattgaagag
ggagcggacatcgtcatggtcaagccggccctggcctatatggacgtcatccgccgggta
aaggacgattacggctaccctgttgcggcctacaatgtcagcggggagtacagcatggtc
aaggccgcggcgcagcggggatgggtggacgaacagaggattgtcatggagatcctcacc
gggctgaagcgcgccggggcggacatcatcattacctatcatgccaaggatgcggccagg
tggcttagggaagggcggcagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system