KEGG   Pelotomaculum thermopropionicum: PTH_1079Help
Entry
PTH_1079          CDS       T00519                                 

Gene name
RfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PTH_1079 (RfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PTH_1079 (RfbC)
Enzymes [BR:pth01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PTH_1079 (RfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1109962..1110405
Genome map
AA seq 147 aa AA seqDB search
MEVRRLKVIPDERGFLMEMLRSDWPEFMNFAQAYVTACYPGVIKAWHYHKLQWDHFVCVA
GMARTVLYDPREGSSTKGKVNVFHLGYLNPVLLKIPPMVYHGFAAEGDKTSLIVNFPTRL
YNYGQPDEFRLPYDDPSIPYRWEAVHR
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
gtggaggtcaggcgcttaaaggtaatcccggacgagcggggtttcctgatggaaatgctg
cgcagcgactggccggaattcatgaactttgcccaggcctatgtaactgcctgctatccg
ggggtaatcaaggcctggcattaccacaaactgcagtgggatcactttgtctgcgtggcc
ggcatggccaggacggtcctgtacgacccgcgggagggcagttccaccaaaggaaaggtg
aacgtatttcacctgggatacctcaatcccgtcctgctgaaaattccgcccatggtatac
cacggatttgcggcagaaggagataaaacctcccttattgttaatttccctacccgcctg
tataattacggccaacccgacgagttccggcttccgtacgacgacccgtccataccgtac
cggtgggaggccgtgcaccggtga

DBGET integrated database retrieval system