KEGG   Pelotomaculum thermopropionicum: PTH_1212Help
Entry
PTH_1212          CDS       T00519                                 

Gene name
DeoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
pth00240  Pyrimidine metabolism
pth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PTH_1212 (DeoA)
Enzymes [BR:pth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PTH_1212 (DeoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: BAF59393
UniProt: A5D2X1
Position
1248660..1249973
Genome map
AA seq 437 aa AA seqDB search
MRMYDIILKKRDGRELTDGEIKYFIEGYTSGDIPDYQAAALLMAVFFQGLNARETAGLTM
AMSRSGDRADLSAIPGIKVDKHSTGGVGDKTTLVLVPLVAAAGVPVAKMSGRGLGHTGGT
VDKLESIPGFRSMLELPELIDQVRRVGAVVVAQTGHLAPADKKLYALRDVTATVDSIPLI
ASSVMSKKIAAGADAIVLDVKAGKGAFMQRPEDAFGLARTMVEIGNQVGRRTVALVTGMD
QPLGYAVGNALEVKEAIAALKGNGPADLLELCLSLGSVMLLLAGRAGNLEEGRNILAGLL
ESGRALDKFEEFIAAQGGDRRITENENLLPAAGIVESLPAPRPGCVQAVHAGRIGRAAML
LGAGRENKESQIDLSVGVVLNKKAGDRVQAGEPLAVLHASDARRLEAAREVVLQAYTIGE
QKPEPQPLVYGMVPEKI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatgtacgatattatcctgaaaaaaagggacggccgggaactgacggacggcgag
ataaaatacttcattgaaggttatacctccggcgacattcccgactaccaggccgccgcc
ctgttgatggccgtattctttcaggggctgaatgccagggagaccgccggcctgaccatg
gccatgagccgttccggggaccgggccgacctttcggccataccggggatcaaggtggac
aagcacagcaccgggggcgtgggggacaagaccaccctggtgctggtgccgctggtggcc
gcggcaggtgtgccggtggcaaagatgtcgggccgggggctgggccataccggcgggacg
gtggacaaactggagtccatacccggcttcaggtcaatgctggagctgcccgaattgatc
gaccaggtgcgccgggtgggagccgtcgtggtggcccagacaggacacctggccccggcc
gataagaagctttacgccctgcgggacgtaaccgccaccgtggacagcatccccctcatt
gccagcagcgtcatgagcaagaagattgccgccggggccgacgccatcgtactggacgtc
aaggcgggaaaaggggccttcatgcaaaggccggaggatgccttcgggctggcccggacc
atggtggaaataggaaatcaggtggggcggcgcaccgttgccctggttaccgggatggac
cagcccctgggctacgccgtgggcaatgccctggaggtgaaggaagccatagccgccctg
aaaggcaatggcccggcagacctgctggaactgtgcctttccctggggtcggtaatgctc
ctgctggccggccgggctgggaatcttgaagaagggcgcaatatcctggccggtttgctg
gaaagcggcagggccctggataagtttgaagaatttattgccgcccagggcggcgaccgg
cgcatcacggaaaatgaaaaccttctgccggccgccgggatcgtggagagcctgccggcg
ccgcgccccggttgcgtccaggccgtccacgccggaagaatcgggcgggccgccatgctg
ctgggggcgggccgggagaataaggagtcgcagattgacctttcggtgggtgtagtttta
aacaaaaaagcgggcgaccgggtgcaggccggggaacctttggcggtgctgcacgccagc
gatgcacgccgcctggaggcagcgcgggaagttgtcctgcaggcgtacaccatcggggaa
cagaagccggaaccgcagcctctcgtttacggcatggttccggaaaaaatttaa

DBGET integrated database retrieval system