KEGG   Pelotomaculum thermopropionicum: PTH_1358Help
Entry
PTH_1358          CDS       T00519                                 

Gene name
MmcD1
Definition
succinyl-CoA synthetase, beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pth01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pth00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pth00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:pth00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1405088..1406203
Genome map
AA seq 371 aa AA seqDB search
MKMFEYMGKELFAKYGLPVPKGRMAPNPDEAAKIAAEIGGPCVVKSQVLIGKRGKAGGIK
FPNSPEEAKKAAEEVFAMTIQGLPVEAVLVEEKLKIDKELYMSITVDGAAKMPVLIASAY
GGMDIEEQPEEYIIKKHIDPEMGMQAFIARDVVRQMGISLNSAHGKQLVSIIQTLYKIFK
EQDAELVEINPLVFSDDKVIAADAKVTIDDDALFRHKDLPYVEDRTATEKAAKDLGLSYV
ELDGDIAVMANGAGITMTTLDTLQYYGGRPANFLDCGGGTGREVTAKALELLLTKNPKVI
FVNIFGGITRCDDVANAIADVKKDKGIPMPIVVRLVGTNQDIGREILKGVGIEAFDFMNE
AAQKAIELTKA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatgtttgaatatatgggcaaggaactttttgccaagtacggtctgcctgtacct
aaaggcagaatggctcctaacccggatgaagcagctaagattgcggccgaaattggcggc
ccttgtgttgtaaaatcccaggtgttaatcggcaagagaggtaaagccggcggcattaag
ttcccgaacagccctgaagaggcaaagaaagcggctgaagaagtatttgccatgaccatt
cagggcctgcctgtagaagcggtcctggtggaagaaaaactgaagatagataaagaactt
tacatgtcgattaccgttgacggggccgctaaaatgcccgtgcttatcgcgtctgcttac
ggcggcatggatattgaagagcagccggaggaatacatcatcaagaaacacatcgatccc
gagatgggaatgcaggctttcatcgcccgcgatgttgtaaggcaaatgggcatttccttg
aacagtgcacatggcaagcaattagtaagtattatccaaaccctttataagatatttaaa
gaacaggatgccgaactggtagaaatcaacccgttggttttcagcgatgacaaggtaata
gcggccgacgccaaagttactatagacgacgatgcccttttccgtcacaaggatctgccg
tacgtcgaggatcgtactgcaaccgaaaaggcagctaaggacctggggctttcatatgta
gagctcgacggcgatattgcggtaatggcaaacggtgccggcattaccatgaccactctg
gacaccctgcagtattacggcggtagaccggccaacttccttgactgcggcggcggcacc
ggccgtgaagtaacagccaaggctttagaacttctccttaccaagaacccgaaagtcatt
tttgtaaatatcttcggaggcatcacccgttgtgacgacgttgccaatgctattgcagac
gtcaagaaagacaagggtattcctatgccaatagtggtccgccttgtgggaacaaaccag
gatatagggcgcgaaattttgaagggggtaggaatcgaggcttttgacttcatgaacgaa
gccgcccaaaaggcaattgagctgaccaaggcatag

DBGET integrated database retrieval system