KEGG   Pelotomaculum thermopropionicum: PTH_1358Help
Entry
PTH_1358          CDS       T00519                                 

Gene name
MmcD1
Definition
succinyl-CoA synthetase, beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTH_1358 (MmcD1)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PTH_1358 (MmcD1)
   00640 Propanoate metabolism
    PTH_1358 (MmcD1)
   00660 C5-Branched dibasic acid metabolism
    PTH_1358 (MmcD1)
Enzymes [BR:pth01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PTH_1358 (MmcD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1405088..1406203
Genome map
AA seq 371 aa AA seqDB search
MKMFEYMGKELFAKYGLPVPKGRMAPNPDEAAKIAAEIGGPCVVKSQVLIGKRGKAGGIK
FPNSPEEAKKAAEEVFAMTIQGLPVEAVLVEEKLKIDKELYMSITVDGAAKMPVLIASAY
GGMDIEEQPEEYIIKKHIDPEMGMQAFIARDVVRQMGISLNSAHGKQLVSIIQTLYKIFK
EQDAELVEINPLVFSDDKVIAADAKVTIDDDALFRHKDLPYVEDRTATEKAAKDLGLSYV
ELDGDIAVMANGAGITMTTLDTLQYYGGRPANFLDCGGGTGREVTAKALELLLTKNPKVI
FVNIFGGITRCDDVANAIADVKKDKGIPMPIVVRLVGTNQDIGREILKGVGIEAFDFMNE
AAQKAIELTKA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatgtttgaatatatgggcaaggaactttttgccaagtacggtctgcctgtacct
aaaggcagaatggctcctaacccggatgaagcagctaagattgcggccgaaattggcggc
ccttgtgttgtaaaatcccaggtgttaatcggcaagagaggtaaagccggcggcattaag
ttcccgaacagccctgaagaggcaaagaaagcggctgaagaagtatttgccatgaccatt
cagggcctgcctgtagaagcggtcctggtggaagaaaaactgaagatagataaagaactt
tacatgtcgattaccgttgacggggccgctaaaatgcccgtgcttatcgcgtctgcttac
ggcggcatggatattgaagagcagccggaggaatacatcatcaagaaacacatcgatccc
gagatgggaatgcaggctttcatcgcccgcgatgttgtaaggcaaatgggcatttccttg
aacagtgcacatggcaagcaattagtaagtattatccaaaccctttataagatatttaaa
gaacaggatgccgaactggtagaaatcaacccgttggttttcagcgatgacaaggtaata
gcggccgacgccaaagttactatagacgacgatgcccttttccgtcacaaggatctgccg
tacgtcgaggatcgtactgcaaccgaaaaggcagctaaggacctggggctttcatatgta
gagctcgacggcgatattgcggtaatggcaaacggtgccggcattaccatgaccactctg
gacaccctgcagtattacggcggtagaccggccaacttccttgactgcggcggcggcacc
ggccgtgaagtaacagccaaggctttagaacttctccttaccaagaacccgaaagtcatt
tttgtaaatatcttcggaggcatcacccgttgtgacgacgttgccaatgctattgcagac
gtcaagaaagacaagggtattcctatgccaatagtggtccgccttgtgggaacaaaccag
gatatagggcgcgaaattttgaagggggtaggaatcgaggcttttgacttcatgaacgaa
gccgcccaaaaggcaattgagctgaccaaggcatag

DBGET integrated database retrieval system