KEGG   Pelotomaculum thermopropionicum: PTH_1386Help
Entry
PTH_1386          CDS       T00519                                 

Gene name
PfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTH_1386 (PfkA)
   01230 Biosynthesis of amino acids
    PTH_1386 (PfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTH_1386 (PfkA)
   00030 Pentose phosphate pathway
    PTH_1386 (PfkA)
   00051 Fructose and mannose metabolism
    PTH_1386 (PfkA)
   00052 Galactose metabolism
    PTH_1386 (PfkA)
  Energy metabolism
   00680 Methane metabolism
    PTH_1386 (PfkA)
Enzymes [BR:pth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PTH_1386 (PfkA)
Protein phosphatases and associated proteins [BR:pth01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PTH_1386 (PfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1435205..1436308)
Genome map
AA seq 367 aa AA seqDB search
MTIKKTVRRIGVLTGGGDCPGLNAVIRAVVKTAIREYRLSVVGFENGFGGLIQNRARELT
EADVAGILPRGGTILGTTNRDNPFSYPMIINGQKVFRDVSDRVVENINIHGIDALIIIGG
DGSLTIGKELFEKKGLQVVGVPKTIDNDLSATDQTFGFDTALNTATEAIDKLHTTAESHH
RVMILEVMGRYAGWIALESGIAGGADVILIPEIPYRIEKVIEKIIERRNLGKKFSLVVVA
EGAKPLGGEMVIQRRVEDSFEPIRLGGIGNAVASQIEEGTGMETRVTVLGHLQRGGIPTA
FDRILATRYGTGAVNLVMAGKFGEMVCLRTPHIMSVPLAEAVGELRLVPVDGDIVRTAKQ
VGISFGD
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgacgataaaaaaaaccgtaagaagaatcggcgtattaacagggggcggtgactgcccg
ggtttaaacgctgtcatccgtgcggttgtaaaaactgccataagggaatacaggctttcg
gtggtcggttttgaaaacggctttggcggtttaatccagaacagggctagggaattgacc
gaggcggatgtggccggcatcctgccgcggggcgggacgattttaggtaccaccaacagg
gacaacccttttagctaccccatgattattaacgggcaaaaggtgtttcgggacgtttct
gacagggttgtggaaaatattaatattcacggcatagacgctctgatcattatcggcgga
gacggtagccttacaatagggaaggagctttttgaaaagaagggcttacaggtggtgggg
gtaccgaaaacgattgacaacgacctttcggccaccgatcaaacttttggttttgacacg
gcgctcaatacggcaaccgaggccatcgataaactgcatacaacggcggagtcacatcac
cgggtaatgatactggaggtaatggggcgctatgctgggtggattgctttggagtcaggc
attgccgggggcgctgacgtcattttaattccagaaattccttatagaatagagaaggta
attgagaaaataattgaaaggcgcaatctgggaaagaagttcagcttggtggtggttgca
gaaggggccaagccgctaggcggggaaatggtgattcaaagaagggtggaggacagtttt
gagcccatccgtctgggcggtatcggaaatgcggttgccagtcagattgaggaagggacc
gggatggaaacacgggtaacggtgctggggcaccttcagagggggggtatcccgactgct
tttgaccgcatcctggccacccgctacggcacaggggcggtaaatcttgttatggccgga
aagttcggcgagatggtctgcctgcgtacaccgcacataatgtctgttccgctggccgag
gcggtgggcgagttgcgcctggtcccagtagatggcgatatagtcaggacagcaaagcag
gttggaatttcttttggtgattag

DBGET integrated database retrieval system