KEGG   Pelotomaculum thermopropionicum: PTH_1584Help
Entry
PTH_1584          CDS       T00519                                 

Definition
(GenBank) putative aldehyde/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
pth00010  Glycolysis / Gluconeogenesis
pth00071  Fatty acid degradation
pth00350  Tyrosine metabolism
pth00620  Pyruvate metabolism
pth00625  Chloroalkane and chloroalkene degradation
pth00626  Naphthalene degradation
pth00650  Butanoate metabolism
pth01100  Metabolic pathways
pth01110  Biosynthesis of secondary metabolites
pth01120  Microbial metabolism in diverse environments
pth01130  Biosynthesis of antibiotics
pth01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTH_1584
   00620 Pyruvate metabolism
    PTH_1584
   00650 Butanoate metabolism
    PTH_1584
  Lipid metabolism
   00071 Fatty acid degradation
    PTH_1584
  Amino acid metabolism
   00350 Tyrosine metabolism
    PTH_1584
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PTH_1584
   00626 Naphthalene degradation
    PTH_1584
Enzymes [BR:pth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PTH_1584
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PTH_1584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: BAF59765
UniProt: A5D1W0
Position
complement(1664398..1667100)
Genome map
AA seq 900 aa AA seqDB search
MPELAEKDRPGDESAKSKIDELVGKAQEALCRFLEYGQEDVDRIVKAMALAGLDQHMELA
RMAVEETGRGVLEDKITKNIFATEYVYHSIKYHKTVGIINKNEEEDYEEVAEPAGVIAGV
TPVTNPTSTTLFKSLISIKTRNPIVFCFHPGAQRCSAAAAKIMLNAAVAAGAPEHCIGWV
EQPSIEAAKMLMAHPGVSLILATGGSAMVRSAYSSGKPALGVGPGNVPCYIEKSAGLRRA
VTDLILSKTFDNGMICASEQGLVVDREVAGAVEHLLSQYGCYFMNPGEVKLLERLATCGE
SCSMSPEVVGRPAEEIARMAGFPVPPGTKILIARLGGVGPEYPLSREKLCPILAYYTVAS
WQEGIELCEKIVEFGGMGHSAVIHSGDERLIGEFARRIMAGRIIVNAPATHGAIGDIYNT
NMPSLTLGCGSFGRNTTTANVSAVNLINIKRVAKRRVNMQWFKVPERVYFERGSVQYLSK
MPGMARAFIVTDRVMADLGYVEKIKYHLDKREPRPVVEVFSEVEPDPSLGLVLKGRELMN
RFNPDTIIAVGGGSVIDAAKGMWLFYEHPGVEFEFLKLKFLDIRKRTYKYPKLGRKARLV
AIPTTSGSGSEVTAFAVLTDRGKDLKYPLADYELTPDVAIVDPDFVDTLPPSLVADTGMD
VLAHSIEAYVSVMASDYTDALALKAIELVFKYLPRSWREGDREAREKMHNASTIAGMAFT
NAFLGINHSLAHKVGGEFGIPHGRINAVLMPYIIEYNAGLPSKFVSFPKYEYYIAPEKYR
RIAAHLGLPATSPEEGVGSLIGAIRELNRSLGIPETLAGLGIGREDFTAKLPLLAEKAFE
DQCTTTNPRLPLIAELEEILRRAYGAELHAEDRTRHEKETIDDLPFIQPVAGTGSQMPLQ
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactggcggaaaaagacaggcccggtgatgaaagcgccaaaagtaagatcgat
gaactggtggggaaagcgcaggaggccttgtgccggtttttggaatacggccaggaagac
gtggacaggatagttaaggcaatggccctggccggtcttgaccagcacatggaactggcc
aggatggccgttgaggaaaccggcaggggagtgcttgaggataaaattaccaagaacatt
tttgctacggaatacgtttatcacagcattaaataccataaaaccgtcggcattataaat
aaaaatgaagaagaggactatgaagaagtggccgagccagccggagtgatagccggggtg
accccggtaaccaatcccacctccaccactttgttcaaatccctaatttccattaaaacc
agaaaccccatagtcttttgttttcaccccggcgcgcaacggtgtagtgccgcagcggcc
aaaataatgcttaacgcggcagttgccgccggagcaccggaacattgcatcggctgggtc
gaacagccctcaatagaggctgccaaaatgctgatggcccacccgggcgtttcgctgatc
cttgctaccgggggctcggccatggtccggtcggcctacagcagcggcaagccggcgctg
ggagtgggaccgggcaatgtgccctgctatattgagaagtcggccggcctgagaagggcg
gtaaccgacctgattcttagcaagacctttgataacggcatgatctgcgcttctgagcag
ggcctggtggttgaccgggaagtggccggcgcagttgagcacctcttgtcgcagtacggc
tgctattttatgaatcccggtgaagtaaaactgctcgagcgcctggctacgtgcggcgag
tcgtgttccatgagcccggaggtggtaggccggccggcggaggagattgcccggatggcc
ggttttcctgtgccgcccgggactaaaatccttattgccaggctgggcggggtggggccg
gaatatcccctttcccgcgaaaagctatgccccatcctggcttattacaccgtcgctagc
tggcaggagggaatcgaactgtgtgaaaaaatagtggagtttggcgggatgggccactcg
gcagtaatccattcaggcgatgaaaggcttatcggcgagtttgcccgcaggataatggcc
gggcggatcatcgtaaatgctcctgccactcatggggcaataggcgatatctataacacc
aatatgccctccctgaccctgggctgcggctcttttggcaggaacaccaccacggccaac
gttagcgccgtcaatcttatcaatatcaaaagggtggccaagaggcgggtaaacatgcag
tggtttaaagtgcccgaaagggtttatttcgaaaggggctcggtgcagtacctttccaaa
atgcccggcatggccagggcgtttattgttaccgaccgggttatggccgacctgggatat
gtggaaaagataaaatatcacctcgataaaagagagcccaggccggtggttgaagtattc
agcgaggttgaaccggatccttccctcggccttgttttgaagggccgtgaactgatgaac
cggtttaacccggatactattatagccgttggaggcggttcggtcatcgacgccgccaaa
gggatgtggcttttttacgagcatcccggggttgaatttgaatttctgaagttgaagttc
ctggacatccgcaaacgcacctacaaatatcccaaactggggcggaaagcccgcctggtg
gccatccccaccaccagcgggagcggctcagaagtaactgcctttgccgttcttaccgac
cgtggcaaggacctcaaataccccctggcggactacgaactgacgccggatgtagctatt
gtagacccagattttgttgataccttgcccccctccctggtggccgataccggtatggac
gttctggcccacagtatagaggcttatgtttcggtcatggcttcggactataccgatgcc
ctggccttgaaggcaattgaactggtttttaaatacctgccccgctcctggcgtgaaggc
gaccgggaggcgcgggaaaaaatgcataacgcctcgactattgccgggatggcctttacc
aatgcttttcttggcatcaaccacagcctggcgcacaaggtagggggcgagttcggcatt
ccgcacggccggattaacgccgttttgatgccttacataatagaatacaatgccggcctg
ccgtccaaatttgtttcttttccaaaatacgaatactacattgcgccggaaaagtaccgc
cggattgcagcccatctgggcctgcccgcaacttcgccggaggagggggtcggcagcctg
atcggggcaatacgtgaactcaacagatcccttggcataccggaaacgctggccgggctg
ggcattggccgggaagattttacagcaaagcttcctcttttggcagaaaaagcttttgag
gatcagtgcaccactaccaacccaaggctgccgctgattgccgaactcgaagagatattg
cggcgggcttacggggcagagctgcatgcggaagacaggacccggcatgaaaaagaaaca
attgatgacttgccgtttattcaacctgttgccggaaccggaagccagatgccgctgcaa
tag

DBGET integrated database retrieval system