KEGG   Pelotomaculum thermopropionicum: PTH_1585Help
Entry
PTH_1585          CDS       T00519                                 

Gene name
MalQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PTH_1585 (MalQ)
Enzymes [BR:pth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PTH_1585 (MalQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1667410..1669485
Genome map
AA seq 691 aa AA seqDB search
MSEKQITLLYRLARLYGIETVYRDFTGNYRHAPLRTLLAALRALGAPVTYLSDVPDAVRE
KMQEKWRHCCEPVAVAWSGKPAPLALRLPARLAECLAGFRLVLENGKEFRWARKLARLPL
LQAVRLEGVGYELRRLDLPSGLPWGYHQLKVELPAGQHEVLIISAPWRAYTAANKRLWGV
FIPLYALHSARSWGAGDFTDLEELLRWTHSLGGGMAGTLPLLAAFLDEPFSPSPYEPVSR
LFWNEFYLDICRVEELKRSSAARELLASPAFQREVAELRQTSLVDYRRIMSLKRRILEHC
AKTCYAENSGRLAGLHRWARENPAAQDYACFRAAAERQRSGWPEWPARMKEGHIQEGDYD
PEAKHYHLYVQWLAHQQLKNLSARARERGQSLYLDFPLGVHSAGYDVWRERNVFATGASC
GAPPDPLYSKGQNWGFPPLHPERIREQGYRYFSACLRNHLQYAGILRLDHIMGLHHLYWV
PEGFPATEGVYVRYRAEEFYAILTLESNRHKAVIVGEDLGTVPGYVRTGMCRHELHRMYI
MALELKGRAGRVLQPVPAVALAALNTHDTPPFAAFWRSRKGTVERVALPVFLYRQGHLAV
PTTQTRAVLEACLKYLAASRARLFLVNMEDLWMETLPQNVPGTAGEYPNWHRKARHALEE
FCQMPEVVEVLHEISFLRDFPACAGKPQLLQ
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaagcagattaccctactttaccggctggcccggttatacggaattgaaacc
gtctaccgcgattttacaggcaactaccgccatgcaccgctccgtacgctgctggcggct
cttcgtgcccttggtgcgccggtaacatatctttccgacgtgccggatgctgtcagggaa
aaaatgcaggagaaatggcggcactgctgtgaaccggtagcagtagcctggagtggaaag
cccgctcccctggccctgcgcctgcccgcccggctggcagaatgccttgccggattcagg
ctggttcttgaaaacggaaaggaatttcgctgggcccgcaaacttgcccgcctgcccctg
ctgcaggcggtacggctggaaggcgtcggttacgagcttagaaggcttgacctgccttcc
ggtttaccctggggatatcaccagctaaaagttgaattgccggcagggcagcatgaagtt
ttgattatatcggccccttggcgggcttacactgcggcaaacaaacggctgtggggggtt
tttatcccgctctacgcccttcattccgcccggagctggggcgccggcgactttaccgac
ctcgaggaattgctgcgctggacccacagcctcggcggcggtatggccggtactttgccc
ttgctggccgcctttctcgacgagccgttttctcccagtccctacgagccggtaagccgc
ctgttctggaatgagttttacctggatatctgccgggtggaagagctgaaaagaagcagt
gcggccagggaactgcttgcctctcctgcttttcaaagggaagttgctgaactcaggcaa
acctccctggtcgactaccgccgcataatgtctttgaagcggagaattctggagcattgc
gccaaaacttgctatgccgaaaactctgggcggttggccggcctgcaccgctgggcccgg
gaaaatcctgcagcgcaggactatgcctgctttcgcgccgctgccgaacggcagcgctcc
ggttggcctgaatggcctgcccgtatgaaagaagggcacatccaggaaggcgactacgat
ccagaagccaagcactatcatctgtacgtacagtggttggcccatcagcaactgaagaac
ctgtccgccagagcaagagaaagaggacaaagcctttacctggattttccgcttggtgtt
cacagcgccgggtacgacgtctggcgcgagcgcaatgtttttgctacgggagccagttgc
ggcgctccgccggatcctttatacagcaaaggacagaactgggggtttcctcctctccat
ccggaacggatccgcgagcagggctatcgttacttctccgcttgtctgcgcaatcacctt
caatatgccggcattctgcgcctggaccacataatgggtctgcatcacctttactgggtg
ccggaaggctttccggccaccgaaggggtatatgtacgctaccgggcggaagagttttat
gcaattctaacgctggagtccaaccggcacaaggccgtaattgtaggcgaggatttggga
accgtacccggttacgtgcgtacaggcatgtgccggcacgaacttcacagaatgtacata
atggcactggaattaaaaggcagagccggccgggttctgcaaccagttcctgccgttgcc
ctggcggcacttaatactcacgacacaccgccctttgccgctttctggcgcagcaggaag
ggaaccgttgaacgagtagccctgcccgtctttttgtaccgccagggccaccttgcagtt
cccacaactcaaaccagggcagtcctggaagcctgcctgaagtacctggccgccagccgg
gccaggcttttcctggtaaacatggaggatctgtggatggaaaccctgccccaaaatgtt
ccgggcacggccggcgaatatcccaattggcacaggaaagcacgccatgccctggaagaa
ttctgccagatgcctgaggttgtggaggtgttgcacgaaatcagctttttaagagatttt
ccggcatgcgccggaaagccccagcttctacaatag

DBGET integrated database retrieval system