KEGG   Pelotomaculum thermopropionicum: PTH_1623Help
Entry
PTH_1623          CDS       T00519                                 

Gene name
TrpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PTH_1623 (TrpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PTH_1623 (TrpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PTH_1623 (TrpA)
Enzymes [BR:pth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PTH_1623 (TrpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1714532..1715353)
Genome map
AA seq 273 aa AA seqDB search
MTGRSRIAKCLENLRAAGKKGLIAFITAGDPGLAGTVEIVRHVAEAGADLIELGIPFSDP
IADGPVIQMASARALAAGATLPGILEAVREIKKVCTKPLLLMGYYNPIYRFGIRQFAAAA
SVAGVDGLIVPDLPYEETRPLREAATEKGMDLIYLVAPVTPDRRLMKIAAEASGFIYCIS
VTGVTGARREIDTDLAAFTGRVRRYTALPLALGFGISGPEQALKASAYCDAVVVGSALVK
AVAECSDAAAAGLAAGQLVARIRAALDSLKGSF
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggcggagcaggattgcaaaatgtctggagaatttgcgtgcagcaggaaaaaaa
gggctgattgcttttatcaccgcgggcgatcccggcctggcaggcacggtggagattgta
cggcacgtggcagaagcaggggcggatctgattgaactggggattcctttctccgatccc
atagccgacgggccggtaatccagatggcttccgcccgggcgctggccgccggcgcaacc
ctgcccgggattctcgaagccgtaagggaaattaaaaaagtatgtacaaaacccctgctc
ctgatgggttactacaatcccatctatagatttgggatacggcagtttgcggccgcagct
tcagttgcaggtgtggacggcctgatagtgcccgacctgccctatgaagaaactcggccg
ctgcgggaagcggcaacggaaaaaggaatggaccttatttaccttgttgcgcccgtcact
ccggacagaaggctgatgaaaattgcagcagaggccagcggctttatttactgcatctcc
gtgacaggggtaaccggggcaagaagggaaattgacacggatctcgccgcttttacggga
agggtgcgccgttataccgccctgccgctggccctggggttcggcatatcaggcccggaa
caggcgctaaaggcttccgcatattgtgatgcggtggtggtaggaagtgctctggtaaaa
gcagttgcagaatgcagcgatgctgcagcagcagggctggcggcaggacaactggttgcc
cggatcagggcagcgcttgacagcctgaagggatctttctag

DBGET integrated database retrieval system