KEGG   Pelotomaculum thermopropionicum: PTH_1624Help
Entry
PTH_1624          CDS       T00519                                 

Gene name
TrpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PTH_1624 (TrpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PTH_1624 (TrpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PTH_1624 (TrpB)
Enzymes [BR:pth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PTH_1624 (TrpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1715350..1716555)
Genome map
AA seq 401 aa AA seqDB search
MADVYKEMPDERGYFGAYGGRFVPETLMPALEELEGAYHFYKNDPEFQGELNYYLRHYVG
RPSPLYFARGLTEYCGGARIYLKREDLNHTGAHKINNTIGQILLARRMGKRRIIAETGAG
QHGVAAATAAALFGFECAVYMGEEDIRRQELNVYRMKLLGARVIPVSAGSRTLKEAMNEA
LRDWVTNVRNTYYLIGSAAGPHPYPAMVRDFQSIIGIEAKSQVLEQAGRLPDYVVACVGG
GSNAIGIFHPFLADRQVRLIGVEAAGRGLDGEEHAATLNRGSPGILHGSLSYILQDKDGQ
VKCAHSIAAGLDYPGVGPEHACMKDTGRVEYTSATDAEALEAFRLLCRTDGIIPALESAH
ALAEAVRLAPDLAKEEVILVNLSGRGDKDIPVVAGARGVSV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttggccgacgtttataaagaaatgccggatgaaaggggttatttcggggcctacgggggg
cgttttgtgccggagacgctgatgccggccctggaggaactggaaggagcttaccatttt
tacaaaaatgatccggaatttcaaggcgaacttaattattatctcaggcattatgtggga
agaccttccccgctttactttgcccgggggctgacggaatactgcggcggagcgaggatt
tacctgaagcgggaggacctaaaccataccggggcccataagataaacaatactatcggg
cagatcctgctggcccgccgaatgggcaagagaaggataattgccgaaacaggggcgggc
cagcacggggtggccgccgccacggcagcagccctgtttggatttgaatgtgcagtctac
atgggtgaagaggacatcaggcggcaggaacttaacgtttacagaatgaagcttctgggg
gcccgggtaattcccgtgtcggccggaagcagaactttgaaggaagcaatgaacgaggct
cttcgcgactgggtgacaaatgtgagaaacacttactatttaatcggttcggcagccggt
ccccatccctacccggccatggtcagggacttccagtcaataatcgggattgaggcaaaa
agtcaggtgctggagcaggcaggccgtctgcccgattacgtggttgcctgtgtgggcggg
ggaagcaatgccattggcattttccatccttttcttgctgatcgtcaggtcaggctaatt
ggagtcgaagcagccggccggggtctggacggtgaagagcacgctgccaccttgaacaga
ggcagccccgggatactgcacgggtcgctgagttacatcctgcaggacaaagatggccag
gtcaagtgcgcccattccatagcggccgggctggattaccccggtgtggggccggagcat
gcctgcatgaaggatacgggccgggttgaatacacgtcggccaccgatgctgaggcactg
gaggctttcaggttgctttgccggaccgacgggattatacctgccctggaaagcgcccat
gccctggctgaggcggtgcggctggcaccggatctcgcgaaggaagaagtgatcctggta
aatctttctggacggggagacaaggatattcctgtggttgcaggtgcccggggggtaagt
gtatga

DBGET integrated database retrieval system