KEGG   Pelotomaculum thermopropionicum: PTH_1680Help
Entry
PTH_1680          CDS       T00519                                 

Gene name
HisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pth01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pth00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1770408..1771721
Genome map
AA seq 437 aa AA seqDB search
MYIQVFRLKEMSAEDYNRIMKRSEVETDSVIGEVKKVIADVKSRGDDALVDYTREFDGIT
ISAEKIRVSPEEIKEAYHKVDRETVEAIKTLAGNVRRFHAAQMPNKMWSMEVSPGLVAGQ
VIIPLDRVGCYVPGGRGWFPSAVMMSVLPARVAGVPEVIVCTPSAPDGSVPPGTLVACDI
CGADAVFRIGGSQAVAAMAYGTQTVPKVDKIVGPGSKWVLAAFKLLYGEVEIGTHAGPGE
GLIIADETADPEFAAADICIQAEHGLDSAGVLVTHVEELAWAVQKKIARHIERLNEYRKN
FVVESLKKYGAIIITSSLEESIAFANDYAVEHLEIMTRDPLHVMQKIKNAGGIYLGHYTP
LSCGCFGSGPNHVLPTGRKAKVSGGLKTADFYKAVTFEYLSREGLASLKDAMVKLAEYEG
FPAHGNAILERFAREQS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtacatccaggtgttcaggctgaaggaaatgtccgctgaagattacaacagaattatg
aagagaagcgaagtagaaacagattctgtaatcggcgaggtaaaaaaagttattgctgat
gttaaaagccgcggcgacgacgccctggtcgattataccagggaatttgacggaataacg
atctctgccgaaaagataagggtatccccggaagaaataaaagaggcttaccacaaggtg
gaccgggaaacagtagaagctataaaaaccctcgcaggcaacgtcaggcgctttcacgcc
gcccagatgccgaacaagatgtggtcgatggaggtatcgccggggctggtagccgggcag
gtaataatcccgctggacagggtcgggtgctacgtccccggcggcaggggctggttcccg
tcggccgtaatgatgtccgtactgcccgccagagttgccggggttcctgaagtgatcgtc
tgcactccttctgcgccagacggctcggttccgccgggaactctcgtagcctgcgacatt
tgtggcgcagatgccgtgttccggattggcggaagccaggctgttgccgcaatggcatac
ggcacccaaacggtgccgaaggttgacaaaatcgtcggccccggcagcaaatgggtactg
gccgctttcaaactgctctacggggaagtggaaattggcacccacgccgggccgggcgag
ggtttaatcattgcggacgaaaccgccgacccggaatttgcggcagccgacatttgcatc
caggccgagcacggcctggactcggcaggcgtactggttacccacgtggaagaactggcc
tgggcggttcagaaaaaaatagccaggcacatcgagcggcttaacgaataccgcaaaaac
tttgtggttgagtctctcaaaaaatacggggccattatcattaccagctcactggaggaa
tcgattgcctttgccaacgattatgccgtggagcacctggagataatgaccagggacccc
cttcacgtcatgcaaaaaattaaaaatgccggcgggatctacctcggacactacacgccg
ctcagttgcggctgctttggttccgggccgaaccacgtcctgcccacgggccgcaaggca
aaggtgtccggcggcttgaaaacggcggacttttataaggccgtcaccttcgaatattta
tccagagagggactggccagcctgaaggatgccatggttaaactggccgaatacgaaggc
ttccctgcccacggcaacgccattttagaaaggttcgccagggagcaaagttaa

DBGET integrated database retrieval system