KEGG   Pelotomaculum thermopropionicum: PTH_1795Help
Entry
PTH_1795          CDS       T00519                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PTH_1795 (gmk)
Enzymes [BR:pth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PTH_1795 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1882295..1882900)
Genome map
AA seq 201 aa AA seqDB search
MENKGLLLVLSGPSGAGKGTVCRALLQNNPSMVLSVSATTRPPREGEEDGVHYYFLEKET
FKKMIEEGQFLEWAEVYGNYYGTPRRFVQEALGRGEDVILEIDIQGALQVKEKIPEAVLV
FLIPPSRSELSLRLVSRGLDLPEEIEKRLNCSADEIKLAERYDYIVVNDDIGRAAGKVEA
IIMAEKSRPRYFKRFFEQFLR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaataaaggcttgctgctggtcttatcgggcccgtcgggggcgggaaagggaacg
gtctgcagggccctcctgcagaataatccttcaatggtattgtctgtttccgctaccacc
aggccgccccgggaaggtgaggaagacggcgtccattattattttttagaaaaagaaacc
ttcaagaaaatgatagaagaagggcagttcctcgagtgggcagaggtgtacggcaactac
tacggcactccccgccgttttgtgcaggaggcgctgggccggggagaggatgtaattctc
gagattgatattcaaggcgcccttcaggtaaaggaaaaaattcccgaagccgtgctggtt
tttcttatcccgccgtccaggagcgaactgtcgttacgccttgtttcacgcggtctggac
ttgcccgaagaaattgaaaaacgcttgaattgtagtgcagatgaaattaaactggccgaa
cggtatgactatatcgtggttaatgacgatattggacgtgcggcgggcaaggttgaggcc
ataataatggctgaaaaatcccgcccgcgttattttaaacggttctttgagcagtttctc
agatag

DBGET integrated database retrieval system