KEGG   Pelotomaculum thermopropionicum: PTH_1858Help
Entry
PTH_1858          CDS       T00519                                 

Gene name
MurA
Definition
UDP-N-acetylglucosamine enolpyruvyl transferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PTH_1858 (MurA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PTH_1858 (MurA)
Enzymes [BR:pth01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     PTH_1858 (MurA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1941806..1943065)
Genome map
AA seq 419 aa AA seqDB search
MQKFVIVGGTRLTGTVRASGSKNATLPIMAACILNGGTSVIHEAPRLLDVSVMKDVLTYL
GAKVTSEGNIITVDSSNIRPLEISEELMRRMRASNLVLGALLARFGKVKISHPGGCQIGS
RPMNLHLKGLQALGATIQEKFGYITAEAEKLSGADIHLDLPSVGATENLMMAAVLAEGVT
TIKNAAREPEIVDLQNFLNNMGARIKGGGTDTIKIEGVRPGHLKPAVHTVIPDRIEAGTH
MVAAAITGGDVTVTNVIPEHLEPLLAKLREAGVDVEVGDDYVRVRGKGRVQAVDIKTMPY
PGFPTDMQPQMMALLTLAEGTSVITETIFENRFKHVPELRRMGADIKVEGQSVIIKGVPR
LSGACVEASDLRAGAALVLAALAAEDGTVLENVYHIDRGYEQMELKYRALGARIIRVNN
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagtttgtgatcgtggggggaacccgcctgacaggaacggtccgggccagcggc
tcaaaaaacgctacgctgccgataatggccgcgtgcattttaaacggggggaccagcgtt
atccacgaggcgcccaggcttctggacgtttcggttatgaaggatgtcctgacttatctt
ggagcaaaggtaaccagcgagggaaacattattaccgttgacagttcgaatattcggccg
ctggagatatctgaagagctgatgcgccgcatgcgggcttccaacctggtcctgggggcg
ctcctggccaggttcggcaaggtaaagatatcccatcccgggggctgtcagatcgggagc
aggccgatgaacctccacctgaagggcctgcaggcgctgggggcgaccatccaggaaaag
ttcggctatatcacggccgaagcggaaaaactgtcgggtgccgatattcaccttgacctg
cccagcgtgggcgccacggagaacctgatgatggcggcagttttggcggaaggcgtcact
accattaaaaacgccgccagggagccggaaatagtggatttgcaaaatttcctgaacaac
atgggcgccaggattaagggcggcggaaccgatacaataaagattgagggagtgcggccg
ggccatttgaaaccggcggttcataccgtcatacccgaccggattgaagccgggacgcat
atggtggccgcagccataaccggcggcgatgtaacggttacaaacgtcattccggagcat
ttggaaccgcttctggctaaactgcgcgaagcaggcgtagatgttgaggtgggcgacgat
tacgtcagggtaagaggaaaggggcgggtgcaggcggtagacataaaaaccatgccttat
ccgggttttcccaccgatatgcagccccagatgatggcccttttaaccctggcggaaggg
accagcgtaataaccgaaaccatctttgaaaaccgcttcaagcatgtgccggagctccgc
cggatgggggcggacatcaaggtcgaaggccagtcggtgataataaaaggggtgccccgg
ctgagcggggcctgtgtcgaggccagcgacctgcgggccggggcggcgctggtgcttgcg
gccctggcggcggaggacggaaccgttctggaaaatgtataccacatcgaccgcggctac
gagcagatggaactcaaatacagggccctgggggcaagaattattagagtcaataattag

  All links  
No link information was found.   
DBGET integrated database retrieval system