KEGG   Pelotomaculum thermopropionicum: PTH_2131Help
Entry
PTH_2131          CDS       T00519                                 

Gene name
Acs
Definition
acyl-coenzyme A synthetases/AMP-(fatty) acid ligases
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTH_2131 (Acs)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTH_2131 (Acs)
   00620 Pyruvate metabolism
    PTH_2131 (Acs)
   00640 Propanoate metabolism
    PTH_2131 (Acs)
  Energy metabolism
   00680 Methane metabolism
    PTH_2131 (Acs)
Enzymes [BR:pth01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PTH_2131 (Acs)
Lipid biosynthesis proteins [BR:pth01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PTH_2131 (Acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2239541..2241526
Genome map
AA seq 661 aa AA seqDB search
MKAEKTGSVESLLTEKRIFSPSSEFAEKALLKSRQQYEEMWRRSIEKPDEFWAEMAEKHI
DWFKKWDAVEEYSFKDDVFVRYFRGAKLNASYNCLDRHLNNWRRNKAALIWQGEPAEESR
TYTYLQLHREVCKFASVLKSLGVKKGDRVTVYMPMIPELVITLLACARIGAIHSVVFGGF
SSEALRDRIIDSQAETLVTANFGLRAGKTLNCKENADEALSNCPAVKNCIVVRRIDRDCN
MMPGRDYWWHELMSAATPACEPEQMDAEDPLFILYTSGSTGKPKGVMHTTGGYMVYATTT
FKYIFDYRDEDVFWCTADIGWVTGHSYIVYGPLSAGATSLMFEGVPNYPQPDRFWEVVEK
YRVNIFYTAPTAIRAMMRDGDRWPLGRDLSSLRLLGTVGEPINPEAWMWYYKVVGKERCP
VVDTWWQTETGGILISPLPGCIPTKPGSATVPFFGVNPKIIRQDGSEAAPNEGGYLVIDK
PWPGIMRGVYGDPNRFKNTYFVQYPGYYFTGDGARRDEDGYFWLMGRVDDVINVSGHRLG
TAEVESSLVAHPKVAEAAVVGFPHEIKGEGIYAYVTVKEGVEATEELKKELIAHVRKEIG
PIASPDKIQFSSALPKTRSGKIIRRILRKIAAGEIGELGDTTTLADPAVVESLVAGRLEA
V
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgaaaaaaccggcagcgtagaatcattacttacagaaaaaagaattttcagc
ccgtcaagcgagtttgctgagaaggccctgcttaagagccggcagcaatatgaagaaatg
tggcgaaggtcaatcgaaaagccggacgagttctgggcggaaatggctgaaaagcatatt
gactggtttaaaaaatgggacgccgttgaagagtacagctttaaagatgacgttttcgtg
cgctatttccggggcgcaaagctcaacgcttcatataactgtctagaccgccatttaaac
aactggcgcaggaataaagcggcgctaatctggcagggcgaaccggcggaggaaagcagg
acctatacctaccttcagttgcaccgggaggtctgcaaatttgccagcgttctgaaaagc
ctcggggtaaagaaaggggaccgggtaaccgtatacatgccgatgattcccgaactggta
atcaccctgctggcctgcgcccggatcggggccatccacagcgtggtgttcgggggattc
agctccgaagcgctgcgtgacagaattatcgactcccaggccgaaacgctggttaccgcc
aacttcggactcagggccggcaaaacgctgaactgcaaggaaaacgccgacgaggccctc
tccaattgccccgccgtaaagaactgcatagtggtcagaaggattgacagggactgcaat
atgatgccagggcgcgactactggtggcatgagctgatgagcgcggcaacgcccgcctgc
gaaccggagcaaatggacgcagaagaccccctcttcatcctctataccagcggcagcacc
ggaaagccaaaaggcgtcatgcatactacagggggctacatggtttacgccacaacaaca
ttcaagtatattttcgattatcgtgacgaagatgttttctggtgcacggcagacatcgga
tgggttacaggtcacagttacatcgtttacggaccgctgtccgcaggagcaacctcctta
atgttcgaaggcgtacctaactatcctcagccggacaggttctgggaagtcgtggaaaag
taccgcgtcaatatattctacaccgcccccaccgccatccgggccatgatgagggacggc
gacagatggccgctcggcagggacctcagcagcctccggctgcttggcacggtgggcgag
ccaattaatcccgaggcctggatgtggtattacaaggtggtgggtaaagaaaggtgcccg
gttgtcgatacctggtggcagacagaaacaggaggcatcttaatttccccgctgccgggc
tgcattcccaccaaacccggctctgccaccgtaccgttcttcggggtaaacccgaagatc
atccggcaggacgggagcgaggccgctccaaacgaaggcggctacctggttatcgacaaa
ccctggcccggcatcatgcgcggcgtttacggcgaccccaacaggtttaaaaacacctat
tttgtccagtacccgggttattactttaccggtgacggggcgcgccgggacgaagacggc
tatttctggctgatgggccgggtggacgatgttattaacgtatccgggcacaggctgggt
acggccgaagtggaaagctcactggtggcgcacccgaaagttgctgaagcggcggtggta
ggttttccgcacgagattaaaggggaaggcatttacgcctacgtcacggttaaggaaggc
gtggaagcaacggaggaactgaaaaaagaacttattgcccatgtccgcaaggaaatcggc
cccatcgcctctccggacaaaatacagttttccagtgccctgcccaaaaccagaagcgga
aaaattattagaagaatactgaggaaaattgcagccggagaaatcggtgagcttggcgac
accaccacgctggccgatcccgcagtggtggaaagcctggtggccggcaggctggaggcg
gtttaa

DBGET integrated database retrieval system