KEGG   Pelotomaculum thermopropionicum: PTH_2215Help
Entry
PTH_2215          CDS       T00519                                 

Gene name
PfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:pth01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pth01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pth00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pth00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pth00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pth00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:pth00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2319742..2320707)
Genome map
AA seq 321 aa AA seqDB search
MLQRIGVLTSGGDSPGMNACIRAVVRKAVYHGLEVMGIKRGFNGFIEGDMVPLHLGSVAD
IIHRGGTILHTARSVQFLNPEGRARANENVKRFGIQGLVVIGGDGSFRGASIFNREYGLP
VVGVPGTIDNDIPGTDQTIGFDTAVNTAVEAINKIRDTATSHERTFVIEVMGRNFGFIAL
AAGLAGGAETILIPERPFSYDEICERLMRGYRRGKLHSIIVVAEGAAGGLEVARKIKERT
GFDTKVTILGHLQRGGTPTAADRILASCLGAKAVELLMAGETRKMVGIKAGKVVALDIED
ALSQTRSIDLDMYSLAGILSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttgttgcagagaattggagtattgaccagcggcggggattcgccgggcatgaacgcctgc
atcagggcggtggtgcgcaaggccgtttatcacggccttgaggttatgggcataaagcgc
ggctttaacggctttatcgagggcgatatggtaccgctgcacctgggttcggtggcagac
atcatccacaggggcggcaccattctgcacacggcccgctcggttcagtttttgaacccc
gaaggccgggccagggccaatgaaaatgtgaagcgcttcggtattcaggggctggtggtg
atcgggggggatggttccttccggggggccagcatttttaaccgggagtacggcctgccg
gtagtgggggtgccgggcaccatagacaacgatatcccgggcaccgaccagaccatcggc
tttgacactgccgtcaacactgccgtcgaggcaataaacaagatcagggacacggccact
tcccacgaaaggacctttgtcatagaagtaatgggcaggaatttcggctttatcgccctt
gctgccgggctggccggaggggcggagaccatcctgatcccggagaggcctttcagctac
gatgaaatttgcgagcggctgatgcggggttatcgccgcggaaagctgcacagcatcatt
gtggtggccgaaggcgccgccggcggcctggaagtggcccggaaaatcaaggagcgcacc
ggctttgatacaaaagttaccattcttggccacctgcagcggggcggcacgcctaccgca
gccgacagaatcctggccagttgcctgggcgccaaggcggttgagctgcttatggccggg
gaaaccagaaaaatggtgggaataaaagcgggaaaagttgttgccctggatatcgaggat
gccttgagccagaccaggtccatcgacctggacatgtacagcctggcaggcatcctgtcc
atttag

DBGET integrated database retrieval system