KEGG   Pelotomaculum thermopropionicum: PTH_2215Help
Entry
PTH_2215          CDS       T00519                                 

Gene name
PfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTH_2215 (PfkA)
   01230 Biosynthesis of amino acids
    PTH_2215 (PfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTH_2215 (PfkA)
   00030 Pentose phosphate pathway
    PTH_2215 (PfkA)
   00051 Fructose and mannose metabolism
    PTH_2215 (PfkA)
   00052 Galactose metabolism
    PTH_2215 (PfkA)
  Energy metabolism
   00680 Methane metabolism
    PTH_2215 (PfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PTH_2215 (PfkA)
Enzymes [BR:pth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PTH_2215 (PfkA)
Protein phosphatases and associated proteins [BR:pth01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PTH_2215 (PfkA)
Messenger RNA biogenesis [BR:pth03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PTH_2215 (PfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2319742..2320707)
Genome map
AA seq 321 aa AA seqDB search
MLQRIGVLTSGGDSPGMNACIRAVVRKAVYHGLEVMGIKRGFNGFIEGDMVPLHLGSVAD
IIHRGGTILHTARSVQFLNPEGRARANENVKRFGIQGLVVIGGDGSFRGASIFNREYGLP
VVGVPGTIDNDIPGTDQTIGFDTAVNTAVEAINKIRDTATSHERTFVIEVMGRNFGFIAL
AAGLAGGAETILIPERPFSYDEICERLMRGYRRGKLHSIIVVAEGAAGGLEVARKIKERT
GFDTKVTILGHLQRGGTPTAADRILASCLGAKAVELLMAGETRKMVGIKAGKVVALDIED
ALSQTRSIDLDMYSLAGILSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttgttgcagagaattggagtattgaccagcggcggggattcgccgggcatgaacgcctgc
atcagggcggtggtgcgcaaggccgtttatcacggccttgaggttatgggcataaagcgc
ggctttaacggctttatcgagggcgatatggtaccgctgcacctgggttcggtggcagac
atcatccacaggggcggcaccattctgcacacggcccgctcggttcagtttttgaacccc
gaaggccgggccagggccaatgaaaatgtgaagcgcttcggtattcaggggctggtggtg
atcgggggggatggttccttccggggggccagcatttttaaccgggagtacggcctgccg
gtagtgggggtgccgggcaccatagacaacgatatcccgggcaccgaccagaccatcggc
tttgacactgccgtcaacactgccgtcgaggcaataaacaagatcagggacacggccact
tcccacgaaaggacctttgtcatagaagtaatgggcaggaatttcggctttatcgccctt
gctgccgggctggccggaggggcggagaccatcctgatcccggagaggcctttcagctac
gatgaaatttgcgagcggctgatgcggggttatcgccgcggaaagctgcacagcatcatt
gtggtggccgaaggcgccgccggcggcctggaagtggcccggaaaatcaaggagcgcacc
ggctttgatacaaaagttaccattcttggccacctgcagcggggcggcacgcctaccgca
gccgacagaatcctggccagttgcctgggcgccaaggcggttgagctgcttatggccggg
gaaaccagaaaaatggtgggaataaaagcgggaaaagttgttgccctggatatcgaggat
gccttgagccagaccaggtccatcgacctggacatgtacagcctggcaggcatcctgtcc
atttag

DBGET integrated database retrieval system