KEGG   Pelotomaculum thermopropionicum: PTH_2281Help
Entry
PTH_2281          CDS       T00519                                 

Definition
beta-glucosidase-related glycosidases and D-alanyl-D-alanine dipeptidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PTH_2281
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PTH_2281
Enzymes [BR:pth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PTH_2281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2385180..2388599)
Genome map
AA seq 1139 aa AA seqDB search
MNAFNKKPGLKKTSLARHGIAKLFLPLAGFLLILFAAPLLAGASGEIPGLVDISRLDPTI
RLDIRYATDNNFTGRVVYPAPRCLLREDVAERLVRVHQKLKESGYGLKVYDGYRPLAVQK
KFWSIMPVEDYVADPFKGSRHNRGAAVDVGLVDSEGNEMPMPSGYDDFTEKARRDYTGAP
EEELRNRAILEEAMVSEGFLPFPSEWWHFDAPGWENYPVSDQPLWAYSGNTVRILSGTRQ
ETKLAGFYMAQDYGLYGDLKCQFTAMEDQDKLITALMNGDADLAVVSPAAAKNRGALPEL
AVLAALYPDFAGKNADGIVLVRKDRLAAERERLLSFARSTLAGLELAEKYPDAAAMAVLR
RNREMSFEDCRQSIVELGKRYKKNAPAALYQEAWTRTFGTEIPSPAIEVFSPEVPSTLPA
RYLCPVTVAAAGELAHLAGDLTQGAERVFGSEAVVVKTGGSEASARLVGLGLSDFGLATA
GVVAEMEAGTGRFAGEAHSVRRVTTLYTSTAGEPVLLIASREVPGPWKEGFKTMAGAFRD
SLRSSFFAPGEARSADSRELDRIISKMTLEEKIGQMLMVSFRQWKSKDVTEINGEIAATI
KKYHLGGVILFRENVAGTGQTAGLVAQLQKASGDIPLFIAVDQEGGRVVRLQTGTVMPGN
MALGAAGSPEDTYAVAKAIGEELNALGINVDLAPVVDVNINPDNPVIGIRSFGSDPQLVA
DMGVAYINGLRDAGVIATVKHFPGHGDTDVDSHLGLPSVPHGPARLKTVELKPFQQAFDQ
KVDMVMTAHVTFPAIDNTKAISKNDGREISIPATLSHKVLTDLVRKEMGFDGVIITDALE
MKAIADHFGPREAVIGAVKAGADIALMPADLDQAYNGLLAAVRSGEIPESRIDESVKRLI
RLKISKGIVKVSDGRFVPGEKATRDLYERLMVAGDVVGGAAHRAIEKRVAEKAVTLLKNE
GDMLPFKLADGKKVVLFAPWDDRLDLMTGELNRIIAEEGFRNVEVKGFVYNELSALTGEQ
KQAVDAADYVVLGSYSYDVTSRTPGKHWLPDFALSTARYALDSGKPLAVMAIRNPYDIMY
MPGVKAYVAVYGAAEGPNIPAGIAVIFGQARPQGRLPVSIPNSSGTGTLYETGTGLSFK
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcttttaataaaaagcccggattgaaaaaaacatcccttgcccggcacgggatc
gcaaaattatttttgccgctggccggcttcttgctgatcctctttgccgcgcctttgctc
gccggggcttccggcgagattcccggcctggtggatatcagccggttggaccccaccatc
cggctggacattcggtatgccacggacaacaatttcaccggccgggtggtttaccccgcc
ccgcgctgcctgctccgggaggacgtggcggaaaggctggtacgcgtccaccaaaaactt
aaagagtcgggttacggcctcaaggtgtatgacggctaccgccccctggcggtgcagaaa
aaattctggtccattatgccggtggaggattatgtggccgatcccttcaaggggtcgcgc
cataaccgcggcgcggcggtggacgtgggcctggtggacagtgagggcaatgagatgccc
atgccctccgggtacgacgatttcaccgaaaaggcccgccgggactataccggcgctccg
gaggaagagctgcgcaaccgggccatactggaggaagccatggtaagcgagggatttctg
ccgtttccctccgagtggtggcattttgacgccccgggctgggagaactacccggtttcc
gaccagccgctctgggcctattccggcaacaccgtgagaatactgtccggaacacgtcag
gagacaaaactggccggtttctacatggcccaggattacgggctctacggcgacctgaaa
tgccagtttaccgccatggaagatcaggacaaattaatcactgcccttatgaatggggac
gcggacctggcggtggtttccccggcggcggcaaaaaacaggggcgccctgccggaactg
gccgtcctggcggccctttacccggattttgcgggcaagaacgccgatggaattgttctg
gtccggaaagaccgtctggcggcggagagggagcggctgctgtcctttgcccgctccacc
ttggcggggctggagctggcggaaaagtacccggatgccgcggccatggccgtgttgcgc
agaaaccgggaaatgtcttttgaggattgccggcagtcgattgttgaactgggtaaaagg
tataagaagaatgcgccggccgccctctatcaggaggcatggacgaggacattcggcacg
gagatcccttcccccgcgattgaggttttcagtcctgaagtgccttccaccctgccggcg
cgctacctttgtcccgtgacggtggccgcggccggagaactggcgcacctggccggggac
ttgacgcaaggagcggagcgggtcttcggatcggaggcggtggtggtgaaaaccggggga
agtgaagccagcgccagactggtgggcctggggttgagcgatttcgggctggccaccgcc
ggcgtggtcgctgaaatggaggccggcaccggcaggtttgcgggggaagcgcattcagtc
cggcgggtgaccactctttacaccagcacggcaggggagccggtgttgctgatcgccagc
cgggaggtccccgggccgtggaaagagggctttaagaccatggccggcgccttccgggac
agtttgagaagcagttttttcgccccgggcgaagcccggagcgccgactcccgggaactg
gaccggattataagcaaaatgactctggaggagaaaatcggccagatgctcatggtttcc
ttcaggcagtggaagagcaaagacgttactgagatcaacggcgaaatagccgcaaccatt
aagaaatatcatttgggcggagtgatcctcttccgggaaaatgtcgcgggcaccggacag
actgccgggttggtggctcagctccagaaggcctccggcgatattccgctcttcatcgcc
gtcgaccaggaaggcgggagagtggtcaggctgcagacgggcaccgtcatgcccggcaat
atggcgctgggcgccgccggatcgccggaagacacctatgccgtggcaaaggcgataggc
gaagaattaaacgccctgggcataaatgtggacctggctcccgtggtggacgtgaatatc
aacccggacaacccggtcatcggcatcaggtccttcggctcagacccccagctggtggcg
gacatgggtgtggcctatataaacggactgcgcgacgccggcgtcatcgccacggtcaaa
cacttccccgggcacggcgacaccgacgtggactcccacctcgggcttccttcggtgccc
cacggtccggccaggctgaaaacggtggagttgaagccctttcagcaggctttcgaccag
aaagtggatatggtcatgaccgcgcacgtcacctttccggcaattgataatacgaaggct
atttcaaaaaatgacggcagggaaatttccataccggcgacgctttcgcacaaagtgctg
accgacctggtaagaaaagagatggggtttgacggggtgatcatcaccgacgccctggag
atgaaagccatcgcagaccacttcgggccgcgggaggcagtgatcggggccgtcaaggcc
ggggcggacatcgcattgatgccggcggaccttgaccaagcgtataacgggctgctcgcg
gcggtaagaagcggtgaaattccggaatccaggattgacgaatcagttaaaagattaatc
cgcttaaaaatctccaaaggcatagtcaaggtttcagatggaagatttgttcccggagaa
aaagcaaccagggatttatatgaaagattgatggttgccggggatgtcgtgggcggcgcg
gcccaccgggcaattgaaaaaagggtggcggagaaagcggtgaccctgctcaaaaatgaa
ggcgacatgctgcccttcaagctggcggacggcaaaaaagtcgtgctcttcgcgccgtgg
gacgacaggctggacttgatgaccggtgaattaaacaggatcatcgcggaagagggattc
cgcaatgtggaagtaaagggttttgtctacaatgagctcagcgccctgaccggcgaacaa
aagcaggctgtggacgcggcggactacgtggtgctgggctcatacagttacgatgtgacc
agcaggacgccggggaaacactggctgccggactttgccctgagcacggcccgttatgct
ctggactccgggaagcccctggccgtcatggccattagaaacccgtacgacatcatgtat
atgcccggggtaaaagcctatgttgcagtttacggcgcggcggaggggcccaacatcccg
gccgggatcgctgtcattttcgggcaagcgcggccgcagggcagactgcccgtttccatt
ccaaacagcagcgggacgggaacactttatgaaaccggaaccggactgtcttttaagtag

DBGET integrated database retrieval system