KEGG   Pelotomaculum thermopropionicum: PTH_2670Help
Entry
PTH_2670          CDS       T00519                                 

Gene name
ThrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
pth00260  Glycine, serine and threonine metabolism
pth00750  Vitamin B6 metabolism
pth01100  Metabolic pathways
pth01110  Biosynthesis of secondary metabolites
pth01120  Microbial metabolism in diverse environments
pth01230  Biosynthesis of amino acids
Module
pth_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PTH_2670 (ThrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PTH_2670 (ThrC)
Enzymes [BR:pth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PTH_2670 (ThrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: BAF60851
UniProt: A5CYT4
Position
2773659..2775158
Genome map
AA seq 499 aa AA seqDB search
MLYESTRGRHGLVSPAEAIKLGISPDGGLFVPAGNVTVSGKQLEIMAGLSYREKAVLILK
EFLSGFPEEEIKACVDLAYAPGKFDAPGIAPVCKLDASLYVLELWHGPTCAFKDMALQIL
PHLLTRAAAMTGEEQTIVILVATSGDTGKAALEGFKNVPGTKIIVFYPEQGVSEVQKLQM
VTQEGENVAVVAVRGNFDDAQAGVKSIFGDREFNRELIKGGYRLSSANSINWGRLVPQIV
YYFSAYLDLMAKGEIGPGEKVNFAVPTGNFGNILAAYYASEMGLPVNRLICASNANNVLT
DFIRTGVYNRNRPFQKTISPSMDILISSNLERLLYHLCGRDSARVRGWMEELNKNGSYRI
DERTRNLIAGIFWAGFAGDDETVETIRSVYRRYGYVVDTHTAVGLNVYEKYRATTGDGTK
TILASTASPFKFNESVARAILGEEAVRGKGELELLEVLSAASGVAVPPGLKNLAAKPVLH
TKSTPKERMKETVRDILKP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgctctacgaaagcaccaggggccggcacggcctggtttccccggcggaagcaatcaag
ctgggcatttcgccggacggcgggctgtttgtccccgccgggaatgtcacggtatccgga
aagcaactggagataatggccggcctgagctaccgggagaaggccgtgctcatcctgaaa
gagtttttgagcggtttcccggaagaagaaataaaggcctgcgtggatctggcatatgct
cccggaaagttcgatgcacccgggatagccccggtgtgcaagctggacgcttccctctat
gtccttgaattgtggcacggccccacctgtgcctttaaggacatggccctgcagatcctg
ccccacctgctgaccagggccgcggccatgaccggcgaagagcagaccattgtaatcctg
gtggccacttcgggcgacaccggcaaggccgccctggaaggctttaaaaatgtgccggga
acaaaaattatcgtgttttacccggaacagggggtcagcgaggtacagaaactccagatg
gtcacccaggagggggagaacgtcgccgtggtggccgtgcggggcaatttcgacgacgcc
caggcgggggtaaaaagcatcttcggggacagggaattcaaccgggagcttataaaaggc
ggctaccggctttcgtcagccaattccatcaactggggcaggctggttccacaaatcgtc
tattatttctccgcctacctggacctgatggccaaaggcgagatcgggcccggcgagaaa
gttaactttgcggtgcccaccggcaacttcggcaacatcctggccgcttattacgccagt
gagatgggcctgccggtcaacaggctgatctgcgcctccaacgccaacaacgtccttacc
gacttcatccgtaccggcgtgtataaccggaacaggccgttccaaaaaaccatttcgcct
tccatggacattctcatttccagcaacctggaaaggcttctgtaccacctttgcgggcgc
gacagcgccagagtgcgggggtggatggaggaattaaataaaaacggttcctaccgcatc
gacgagcgaacccgcaacctcattgccggcattttctgggccggctttgccggcgacgac
gagacggtggaaaccatcaggtctgtttaccggcgctacggctacgttgttgacacccac
acggcggtgggcctgaacgtatacgaaaaataccgcgccacaacaggcgacggcaccaaa
accatcctggcctccacggccagcccattcaagttcaacgaaagtgtggcccgggccatc
ctgggcgaagaggccgtgaggggcaagggcgaactcgagcttctggaggtcctttcggca
gccagcggcgtggcggtgccgccggggcttaaaaacctggccgcaaagccggtgctgcac
acaaagagcacaccaaaggaacggatgaaagaaacggtgagggatatcctgaaaccataa

DBGET integrated database retrieval system