KEGG   Pelotomaculum thermopropionicum: PTH_2678Help
Entry
PTH_2678          CDS       T00519                                 

Gene name
Pcm
Definition
(GenBank) protein-L-isoaspartate carboxylmethyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pth  Pelotomaculum thermopropionicum
Brite
Enzymes [BR:pth01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PTH_2678 (Pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_23 Methyltransf_25 RrnaAD GCD14 Methyltransf_11 MTS
Motif
Other DBs
NCBI-ProteinID: BAF60859
UniProt: A5CYQ6
Position
complement(2780962..2781651)
Genome map
AA seq 229 aa AA seqDB search
MLLKRAAGKEKDDDNRAGERRRMVYEQLISRGIENDDVIQSMLEVPRHRFVPKHLQEYAY
QDGPLAIGEGQTISQPYIVALMIEALEPAPSDRVLEVGTGSGYAAAVLSRIVSVVYTIER
FDSLARGARSLFQSLKYDNIYVRTGDGTKGWPEAAPFDGIIVSAGAPAVPQTLCGQLKPG
GRLVAPVGDKRWQELLVVRRALDGGYNVKKLGTVFFVPLVGEEGWHDET
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgaagcgagccgcaggtaaagaaaaagatgatgacaaccgggccggcgagcgc
cgccggatggtttacgaacagcttatttcacgcggcatagaaaacgatgacgtgattcag
agcatgctcgaagtgccccgccaccgctttgtcccgaagcacctgcaggagtacgcctac
caggacgggccgctcgccatcggggaggggcagacgataagccagccctatatcgtggcg
ctgatgatcgaggccctggaaccggccccgtcggaccgcgtcctggaggtggggaccggc
tcgggctacgcggcagccgtcctttcccgcatagtttccgtggtttacacaatcgagcgc
ttcgacagcctggccaggggggcccgctcccttttccagagtttgaagtacgacaacata
tacgtccgcaccggcgacgggacaaagggatggcccgaggccgcgcctttcgacggcatt
atcgtttcggccggggcccctgcagtgccgcaaaccctgtgcggccagctcaagccgggc
ggccggctggtggcgccggtgggggacaagcgctggcaggaactgctggtggtgcggcgc
gcccttgacggcggctataacgtgaaaaaactggggaccgtctttttcgtcccgctggtt
ggcgaggaaggctggcacgacgaaacgtaa

DBGET integrated database retrieval system