KEGG   Pelotomaculum thermopropionicum: PTH_2734Help
Entry
PTH_2734          CDS       T00519                                 

Gene name
NagC
Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTH_2734 (NagC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTH_2734 (NagC)
   00052 Galactose metabolism
    PTH_2734 (NagC)
   00500 Starch and sucrose metabolism
    PTH_2734 (NagC)
   00520 Amino sugar and nucleotide sugar metabolism
    PTH_2734 (NagC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PTH_2734 (NagC)
   00524 Butirosin and neomycin biosynthesis
    PTH_2734 (NagC)
Enzymes [BR:pth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PTH_2734 (NagC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2833342..2834355)
Genome map
AA seq 337 aa AA seqDB search
MNSFYVIGVDLGGTKIYTALAADDGRVLSEIKLPTEAGRGLQGVIDRIVHSVEQVRENVA
VPPQKVLALALGAPGPLDTAGGVIHFAPNLRWNNVPIRQILEERLSLPVLLDNDANLAAL
GEHVFGAGRGCGNMVYITVSTGVGGGLILDGKLYRGSSDGAGEIGHMTVLPDGPVCSCGN
RGCLEAMASGTAIARAAAELVASGGGRKILAAAGGDPGRINAAAVAAAAAGGDPEAAAII
DRAAGYLGIGVASILNLLNPAMVVLGGGVMEIGEPVWKGVRREVQARALQAARSRARLVP
AELGGRAGVMGAIALALQEIADGNCLPPAAAEHRNGR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagtttttacgtaatcggggtagatctgggcggcaccaagatttacacggccctg
gcggcagatgacggccgggttctttctgaaataaagctgcccacggaggcaggcaggggg
ctgcagggcgtgatcgaccgcattgtgcacagcgtggagcaggtgcgggaaaatgtggcg
gtaccgccgcagaaggtacttgccctggcccttggcgcaccgggccccctggacacggcc
gggggagtcattcattttgcccccaacctgcgctggaataacgttcccatcaggcaaatc
ctggaggaaaggctttccctgccggttctgctggataacgatgccaacctggccgccctt
ggcgagcatgttttcggggccggccggggctgcggcaatatggtttacatcaccgtcagc
acaggcgtgggcggcggcctgatcctggacgggaagctttaccgcggctcttctgacggt
gccggcgagatcggccacatgaccgtcctgccggacggaccggtctgcagttgcggcaac
cggggctgcctggaggcgatggcctccggcacggccattgcccgggcggccgcggaactg
gtggcaagcggcggcgggcggaagatcctggccgccgccggcggcgatccgggcaggata
aacgctgccgcggtagccgcggcggccgccgggggagaccccgaggcggccgcaattatc
gaccgggccgccggctatctgggcattggggtggccagcatcctgaatttgctcaaccct
gctatggtggtacttggcgggggcgttatggaaataggcgaacccgtctggaaaggcgtc
cgccgggaggtgcaggccagggcgctgcaagcggcaaggtcgcgggcccgccttgttccg
gctgagctgggcggccgcgccggggtcatgggcgcaatagccctggccctgcaggaaatt
gcagacggcaactgcctgcctcctgccgccgcggagcaccgaaatgggcggtga

DBGET integrated database retrieval system