KEGG   Pelotomaculum thermopropionicum: PTH_2768Help
Entry
PTH_2768          CDS       T00519                                 

Gene name
GalU
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PTH_2768 (GalU)
   00052 Galactose metabolism
    PTH_2768 (GalU)
   00500 Starch and sucrose metabolism
    PTH_2768 (GalU)
   00520 Amino sugar and nucleotide sugar metabolism
    PTH_2768 (GalU)
Enzymes [BR:pth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PTH_2768 (GalU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2870983..2871861)
Genome map
AA seq 292 aa AA seqDB search
MKRVRKAVIPAAGLGVRFLPATKAQPKEMLPIVDKPTIQYIVEEAIASGISDILIITGRN
KRAIEDHFDRSVELEVQLKKAGKAAELELIQDISQLADIYFVRQKEPLGLGHAIYCARQF
IGNEPFAVLLGDDIVRSEEPCLKQLMNLYEEVQSSVIAVMEVPEEDVSKYGVLDAVEERP
GVYRINDLVEKPAREKAPSRLAVMGRYIIQPGICSILAETRPGAGGEIQLTDALKVLCRE
QPMYGLAFEGKRYDVGDKLGYLQAMVEFALERPDLAGGFRKYLQSICRKLNQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagggtcaggaaagctgttataccggcggccggcctgggggtgcggtttttgccc
gccaccaaggcacagcccaaggaaatgctgccaatcgtggataagcccacaatccagtac
atagtggaggaagccattgcctcgggcataagcgacatcctgattataaccggccggaac
aaacgggccattgaagaccacttcgaccggtccgtggaactggaggtgcaactcaagaaa
gccggcaaggccgcggaactcgagctgatccaggatatcagccagcttgccgacatttat
tttgtgcggcagaaggaaccgctgggcctgggccacgccatttactgcgccaggcagttc
atcgggaacgagccttttgccgtacttctgggcgatgacatcgtgcgcagcgaagagccc
tgcctgaagcagttgatgaacctgtacgaggaggttcagtcctccgttattgccgtaatg
gaagtgcccgaagaggatgtaagcaaatacggggttctggacgcagtcgaggagcgtccc
ggcgtgtaccgcatcaacgacctggtggaaaagcctgcgcgcgagaaagccccgtcccgc
ctggcggtaatggggcgttacatcattcagccgggcatttgctccattcttgccgagacc
aggcccggggcgggaggggagatccagcttaccgacgccctgaaggtgctgtgccgggag
cagcccatgtacggcctggccttcgaggggaagcgttacgacgtgggcgacaagctcggc
tacctgcaggccatggtcgaatttgccctggaaaggccggacctggccggcggcttccgg
aaatacctgcagtccatctgcaggaagctcaaccagtaa

DBGET integrated database retrieval system