KEGG   Pelotomaculum thermopropionicum: PTH_2768Help
Entry
PTH_2768          CDS       T00519                                 

Gene name
GalU
Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pth  Pelotomaculum thermopropionicum
Pathway
pth00040  Pentose and glucuronate interconversions
pth00052  Galactose metabolism
pth00500  Starch and sucrose metabolism
pth00520  Amino sugar and nucleotide sugar metabolism
pth01100  Metabolic pathways
pth01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pth00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PTH_2768 (GalU)
   00052 Galactose metabolism
    PTH_2768 (GalU)
   00500 Starch and sucrose metabolism
    PTH_2768 (GalU)
   00520 Amino sugar and nucleotide sugar metabolism
    PTH_2768 (GalU)
Enzymes [BR:pth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PTH_2768 (GalU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: BAF60949
UniProt: A5CYG6
Position
complement(2870983..2871861)
Genome map
AA seq 292 aa AA seqDB search
MKRVRKAVIPAAGLGVRFLPATKAQPKEMLPIVDKPTIQYIVEEAIASGISDILIITGRN
KRAIEDHFDRSVELEVQLKKAGKAAELELIQDISQLADIYFVRQKEPLGLGHAIYCARQF
IGNEPFAVLLGDDIVRSEEPCLKQLMNLYEEVQSSVIAVMEVPEEDVSKYGVLDAVEERP
GVYRINDLVEKPAREKAPSRLAVMGRYIIQPGICSILAETRPGAGGEIQLTDALKVLCRE
QPMYGLAFEGKRYDVGDKLGYLQAMVEFALERPDLAGGFRKYLQSICRKLNQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagggtcaggaaagctgttataccggcggccggcctgggggtgcggtttttgccc
gccaccaaggcacagcccaaggaaatgctgccaatcgtggataagcccacaatccagtac
atagtggaggaagccattgcctcgggcataagcgacatcctgattataaccggccggaac
aaacgggccattgaagaccacttcgaccggtccgtggaactggaggtgcaactcaagaaa
gccggcaaggccgcggaactcgagctgatccaggatatcagccagcttgccgacatttat
tttgtgcggcagaaggaaccgctgggcctgggccacgccatttactgcgccaggcagttc
atcgggaacgagccttttgccgtacttctgggcgatgacatcgtgcgcagcgaagagccc
tgcctgaagcagttgatgaacctgtacgaggaggttcagtcctccgttattgccgtaatg
gaagtgcccgaagaggatgtaagcaaatacggggttctggacgcagtcgaggagcgtccc
ggcgtgtaccgcatcaacgacctggtggaaaagcctgcgcgcgagaaagccccgtcccgc
ctggcggtaatggggcgttacatcattcagccgggcatttgctccattcttgccgagacc
aggcccggggcgggaggggagatccagcttaccgacgccctgaaggtgctgtgccgggag
cagcccatgtacggcctggccttcgaggggaagcgttacgacgtgggcgacaagctcggc
tacctgcaggccatggtcgaatttgccctggaaaggccggacctggccggcggcttccgg
aaatacctgcagtccatctgcaggaagctcaaccagtaa

DBGET integrated database retrieval system