KEGG   Phaeodactylum tricornutum: PHATRDRAFT_10799Help
Entry
PHATRDRAFT_10799  CDS       T01075                                 

Definition
malonyl-coa decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
pti  Phaeodactylum tricornutum
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PHATRDRAFT_10799
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PHATRDRAFT_10799
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    PHATRDRAFT_10799
Enzymes [BR:pti01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     PHATRDRAFT_10799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 326 aa AA seqDB search
HLKQLDTFLRRLLSTWFSPGLLEVQRITYDGTPASIIEQIVRQEAVHPVKNLDDLRTRFG
PDRRVYALFHVLLPERPLVVLHTSLQPEIPAYMNQVYNEGSLRSDARVAAFYSISNLQAG
LSGVGLGEHLIKTAVHRLQGRIGLDTFVTLSPVPRFRKWLEERVQHVTGKFASNDLVVGE
DLAKLSHFLQCREDEAVSRMVETLRQEGPSCLDDNAVEVENLVAPLLRGTLAKLAARYLV
TETHRRKPLDGVARFHVGNGAILHRINVNADTSRKGWHNSFGIMVNYRYDLEQLPTNVTQ
YEAEYRIPLGEDVQALLDESLPPSFA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
catttgaaacagctagatacgtttctgcgacgattgctatctacctggttctctccaggg
ctactcgaagtgcaacgtattacctacgatggaacacctgcatcgataattgaacaaatt
gttcgtcaagaggcagttcatcccgtcaagaatttagatgatttgcgcactcgatttggt
cccgacaggcgagtttacgccctctttcatgttctgctcccggaacgtcctctcgttgta
ttgcatacatctttacaaccagaaatacccgcatacatgaatcaggtctacaacgaaggt
tccttgcgtagtgatgcaagggtcgctgccttctattccatttcaaatctgcaagctggg
ctatctggagtcggcctgggagaacaccttattaaaacagcggtccatcgtctgcagggt
cgtattggcctcgacacgttcgtgacattgtctccagttccacgctttcggaaatggctg
gaagaacgtgtccagcacgtcactggcaaattcgcatccaacgatcttgtcgtaggcgaa
gatttggcaaagctttcccactttttgcaatgtcgtgaagatgaggcagtctcgcgtatg
gtagaaacattgcgtcaagaaggtccttcctgtttggatgacaatgcagttgaggttgag
aatctcgtcgccccgctcttacgcggcactcttgccaaacttgcggctcgctatttggtg
acggaaacgcaccgccgtaaacctctcgacggtgtcgcccgctttcatgtaggtaacggc
gcaattttacaccgcatcaacgtcaatgccgacacaagccgtaaggggtggcacaacagt
ttcggtataatggtgaactatcgctacgatctggagcagttgccaacgaacgtcacacaa
tacgaggccgaatatcggatccctttgggagaggatgttcaagcattgcttgatgagtcc
ttgcctccttcgtttgcttag

DBGET integrated database retrieval system