KEGG   Phaeodactylum tricornutum: PHATRDRAFT_11131Help
Entry
PHATRDRAFT_11131  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pti  Phaeodactylum tricornutum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PHATRDRAFT_11131
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PHATRDRAFT_11131
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 207 aa AA seqDB search
PLIVCGPSGVGKGTIIQRFMEQRGGDQFFAFTTSHTTRAPREGEVDGVHYHFVSSERMHE
FLAQDYFVESAHVHGNYYGTSWQSLRDVQQASINTNTDTSRSMKRPLMDIDVQGVQNIKI
LEKKPPLGILLRPQYIFIAPPSIAELQVRLVGRGSESPETIQKRVGNAAKEVEYGRRLGN
FDKIVTNDDLDRAVEDFDTAVRDLYGL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
cctctgattgtctgtggaccgtccggggtcggcaagggtacaatcattcagcgattcatg
gagcaacggggtggcgaccaattctttgcgttcacgacgtcacacaccacaagagctccc
cgggaaggtgaagtcgatggggttcactatcactttgtctcgagcgaacgaatgcacgaa
tttctggcgcaagactactttgtcgaatccgcacacgtacacggaaactactacggcaca
tcttggcaatccctgcgagacgttcagcaagcatctattaataccaataccgacacctct
cgttctatgaaacgacccttgatggatatcgacgtacagggtgtgcaaaacatcaagatt
ctcgagaagaagcctcctctagggatactactgcgcccccagtatattttcattgcgcca
ccttcaattgcggagttgcaggtaagactcgtgggtaggggtagcgaaagtcccgaaaca
attcaaaagagagtaggaaatgccgccaaggaagtcgaatacggccggcggttgggaaat
ttcgacaagattgtgaccaacgatgatctcgatcgggccgtggaagactttgacacagcg
gtgcgagatctgtatggtctgtaa

DBGET integrated database retrieval system