KEGG   Phaeodactylum tricornutum: PHATRDRAFT_11777Help
Entry
PHATRDRAFT_11777  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pti  Phaeodactylum tricornutum
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:pti00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    PHATRDRAFT_11777
Enzymes [BR:pti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     PHATRDRAFT_11777
Protein phosphatases and associated proteins [BR:pti01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     PHATRDRAFT_11777
Transcription machinery [BR:pti03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     PHATRDRAFT_11777
Messenger RNA biogenesis [BR:pti03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     PHATRDRAFT_11777
Spliceosome [BR:pti03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    PHATRDRAFT_11777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 309 aa AA seqDB search
MESIVSITERLLGLRGSPPGTLASLAENEIKLVCSRVRPVLMDQPMFLELEAPIKICGDI
HGQFTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSIETICLLMCYKIRYPENFFILRGNH
ESAGINRIYGFYDECKRRYSIKLWKVFSDVFNCLPASALVDEKILCMHGGLSPELQSLHQ
ITDLQRPCDVPDVGLLCDLLWSDPDANISGWGENDRGVSFVFGADVVTKFLEVHDLDLLV
RAHQVVEDGYEFFAGRRLVTLFSAPNYCGEFDNAGGMISVDEELMCSFQILKPSSRSARF
GRNPAASES
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcattgtttctataacggagcgcttgctgggtttgcgagggagtccaccggga
acactggccagtctcgccgaaaacgaaattaaactggtgtgcagccgagtaagaccagta
ctgatggaccaacccatgttcctcgagttggaggccccgattaagatttgcggggatatt
cacggacagttcactgatttgctgcgcctcttcgagtacggcggatttccaccagaagct
aactacttgtttctgggcgactacgtagatcgaggaaaacaatcaatcgaaactatctgt
cttttgatgtgctacaaaattcgctatccggaaaactttttcattttgcggggtaatcac
gaaagtgccggtatcaatcggatctatggcttctacgacgaatgcaaacgccgttacagt
attaagctgtggaaagtcttttccgacgtattcaattgcttgccggcgtcagcgttggtt
gacgagaaaatattgtgcatgcacggagggctttccccagagttgcaatcactgcatcag
attaccgaccttcaaaggccctgcgatgtccctgacgttggtttgctatgcgatttgcta
tggagcgaccccgatgccaatatttcaggatggggcgagaacgacaggggcgtgtcgttc
gtttttggcgcggacgttgtgaccaagtttctcgaagtgcacgatttggatttgctggtg
cgcgctcatcaggttgtagaggacggctacgaattctttgcgggccgccgactggtgacg
ctgtttagtgctccgaattattgcggagagtttgataatgcgggagggatgatatcggtc
gacgaagagctcatgtgcagttttcaaatcctcaaaccgtcgagtcgatccgcaaggttc
ggacgtaacccggcggcctctgaatcgtga

DBGET integrated database retrieval system