KEGG   Phaeodactylum tricornutum: PHATRDRAFT_11823Help
Entry
PHATRDRAFT_11823  CDS       T01075                                 

Gene name
H2B-1a
Definition
histone H2B isoform 1a
Orthology
K11252  
histone H2B
Organism
pti  Phaeodactylum tricornutum
Brite
Exosome [BR:pti04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PHATRDRAFT_11823 (H2B-1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 116 aa AA seqDB search
MAKTPSKQSAKAPKKAATGTKSKKRTETYSSYIYKVLKQVHPDTGISKKGMSIMNSFIND
IFERIATEAGKLATYNKKATLSSREIQTAVRLMLPGELAKHAVSEGTKAVTKFSSS
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccccgtccaagcaatccgccaaggcgcccaagaaggcggctaccggcacc
aaatcgaagaagcgtacggagacgtacagttcttacatttacaaggtcctcaagcaggtc
cacccggataccggtatttccaagaagggtatgtctatcatgaactccttcattaacgat
atctttgaacgtattgctaccgaagccggtaagctggctacttacaacaagaaggcgacg
ctcagtagtcgtgaaatccagaccgctgttcgtctcatgcttcccggtgaactcgccaag
catgccgtctcggaaggaaccaaggctgttaccaagttctccagttcgtaa

DBGET integrated database retrieval system