KEGG   Phaeodactylum tricornutum: PHATRDRAFT_12339Help
Entry
PHATRDRAFT_12339  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
pti  Phaeodactylum tricornutum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 275 aa AA seqDB search
MLRVNGIPYAKLGVIGKGGSCKVYRALSKNCSVYAIKKVKLSGMDEKAIAGYSNEIALLK
RLRDNPAIIQLLDSEVDLQRHAIFLVMEVGEVDLNHVLQQQAAAQTNGSCGDNKRTLNMN
FIRLTWQQMLSAVHCIHEERIIHGDLKPANFLFVRGTLKLIDFGIAKAIQNDDTTNIYRE
SQIGTLNYMSPEAILDTGTGNSGTRIKTGRASDIWSLGCILYQMIYGRTPFAELHMIQKL
QAIVNPEHKISFPFCVDESAIDVMQSCLRRNPDER
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgctccgagtgaacggaatcccttatgcgaagttgggtgtcatcggaaagggtggctcc
tgtaaagtatacagggcgctgtctaagaactgctctgtctacgccatcaagaaggtcaaa
cttagtggtatggacgagaaggccatagccggatattcgaatgaaattgctttactaaag
cgccttcgagacaatcctgcgatcattcaattactagatagcgaagtggatcttcagcgc
cacgctatctttttagtaatggaagtcggcgaagtcgatctaaaccacgttcttcaacag
caagcagcagcacagactaacggttcttgtggagataacaagcggactctcaatatgaat
tttatacgtttgacatggcaacagatgctaagtgcagtgcactgcatccacgaagagcga
atcatccatggagatttgaaacctgcgaatttcctatttgtacgaggcacactgaaactt
atcgattttggaatcgctaaggctattcagaacgacgatacaactaacatctaccgggaa
agtcagattggtacacttaactatatgtcgcctgaagcgattttggataccgggacagga
aatagtggaacacgaataaaaacgggacgggcgtctgacatatggtcactaggttgcata
ttatatcaaatgatatatgggcgaactccatttgctgagctgcatatgatacagaagctg
caagctatcgtaaatccagagcacaaaatcagttttccattctgtgtcgacgaaagtgcc
atagatgtaatgcagagttgtctacgaaggaaccctgatgaaaga

DBGET integrated database retrieval system