KEGG   Phaeodactylum tricornutum: PHATRDRAFT_12339Help
Entry
PHATRDRAFT_12339  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K08866  serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PHATRDRAFT_12339
Protein kinases [BR:pti01001]
 Serine/threonine kinases: Other
  TTK family
   PHATRDRAFT_12339
Chromosome and associated proteins [BR:pti03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     PHATRDRAFT_12339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1 APH Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 7200931
NCBI-ProteinID: XP_002180216
JGI: 12339
UniProt: B7FYQ6
Position
8
AA seq 275 aa AA seqDB search
MLRVNGIPYAKLGVIGKGGSCKVYRALSKNCSVYAIKKVKLSGMDEKAIAGYSNEIALLK
RLRDNPAIIQLLDSEVDLQRHAIFLVMEVGEVDLNHVLQQQAAAQTNGSCGDNKRTLNMN
FIRLTWQQMLSAVHCIHEERIIHGDLKPANFLFVRGTLKLIDFGIAKAIQNDDTTNIYRE
SQIGTLNYMSPEAILDTGTGNSGTRIKTGRASDIWSLGCILYQMIYGRTPFAELHMIQKL
QAIVNPEHKISFPFCVDESAIDVMQSCLRRNPDER
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgctccgagtgaacggaatcccttatgcgaagttgggtgtcatcggaaagggtggctcc
tgtaaagtatacagggcgctgtctaagaactgctctgtctacgccatcaagaaggtcaaa
cttagtggtatggacgagaaggccatagccggatattcgaatgaaattgctttactaaag
cgccttcgagacaatcctgcgatcattcaattactagatagcgaagtggatcttcagcgc
cacgctatctttttagtaatggaagtcggcgaagtcgatctaaaccacgttcttcaacag
caagcagcagcacagactaacggttcttgtggagataacaagcggactctcaatatgaat
tttatacgtttgacatggcaacagatgctaagtgcagtgcactgcatccacgaagagcga
atcatccatggagatttgaaacctgcgaatttcctatttgtacgaggcacactgaaactt
atcgattttggaatcgctaaggctattcagaacgacgatacaactaacatctaccgggaa
agtcagattggtacacttaactatatgtcgcctgaagcgattttggataccgggacagga
aatagtggaacacgaataaaaacgggacgggcgtctgacatatggtcactaggttgcata
ttatatcaaatgatatatgggcgaactccatttgctgagctgcatatgatacagaagctg
caagctatcgtaaatccagagcacaaaatcagttttccattctgtgtcgacgaaagtgcc
atagatgtaatgcagagttgtctacgaaggaaccctgatgaaaga

DBGET integrated database retrieval system