KEGG   Phaeodactylum tricornutum: PHATRDRAFT_12752Help
Entry
PHATRDRAFT_12752  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
pti  Phaeodactylum tricornutum
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:pti04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 348 aa AA seqDB search
GVVGLRNLGNTCFLNSSLQCLSATIPLTDYFLGYDYRSEINQHNVLGTGGKLATAYAELM
KELWLQAAPVSGYTKISARVVKPTRFKSSLESFAPQFLGTSQHDAQELLSFLLDGIHEDL
NRIPKKPYIEDRDCDGTHDERDAIEAWKNYLRRDKSLVVDIFQGQLRNTLTCLTCRHVNV
RFEPFMYLSLPLNDDSHTLDDCLRLYLAEERLVRENQWYCSVCQTHRDATKKTDLWIVPA
ILIVHLKRFKFNEYGQLGSKNNACIRYPVGDSWDLSGVVCSRGSEEPLYDLYAVSNHVGD
LGGGHYTAYSLNRFDDHWYEFNDTTCRKIDDRTLQGNSSSAYLLFYNR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
ggcgttgttggtctgagaaatcttgggaatacctgctttcttaacagtagtttgcagtgt
ttgagtgctactattccactcaccgactactttttgggttacgactaccgatccgaaatc
aaccagcacaacgttttgggaacggggggtaaactggcgacggcctacgcggaactcatg
aaagagctctggttacaggcggcccccgttagcggctacaccaaaatatcagcacgagta
gtcaaaccgacgcgattcaaaagcagtctcgagagtttcgccccacagtttctcggtacg
tcgcaacacgatgcccaagaattgctgtcctttttattggacggtattcacgaggacttg
aatcgcattcctaagaagccatatattgaagatcgagattgcgacggcactcatgatgag
cgtgatgcgattgaagcttggaaaaactacctgcgccgcgacaagtccctggtggtggac
atttttcaaggtcaactgcgcaataccttgacgtgcttgacctgccggcacgtcaacgtg
cgcttcgaacccttcatgtacctctcactcccattgaacgacgacagccacactctcgat
gattgtctgcgcctctatttagcggaagaacgattagttagagagaatcaatggtactgc
agcgtttgtcaaacgcaccgggacgctacgaaaaagaccgacttgtggatcgttccagct
attttgattgtccatctcaaacgctttaagttcaacgaatacggtcagctaggctcgaaa
aacaatgcttgtattaggtatcccgtgggtgactcatgggatttgtccggagtggtatgc
agtcgggggagcgaagaacccctctacgatttgtacgcagtttcaaaccacgtcggggat
ctgggtgggggacactatacggcatattcactcaatcgcttcgacgaccactggtacgaa
tttaacgataccacttgtcgcaagatcgatgatcgaacgctccaaggcaattcatcgtcg
gcctatttattattttacaatcgc

DBGET integrated database retrieval system