KEGG   Phaeodactylum tricornutum: PHATRDRAFT_12757Help
Entry
PHATRDRAFT_12757  CDS       T01075                                 

Gene name
ADH_2
Definition
(RefSeq) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00010  Glycolysis / Gluconeogenesis
pti00071  Fatty acid degradation
pti00350  Tyrosine metabolism
pti01100  Metabolic pathways
pti01110  Biosynthesis of secondary metabolites
pti01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHATRDRAFT_12757 (ADH_2)
  Lipid metabolism
   00071 Fatty acid degradation
    PHATRDRAFT_12757 (ADH_2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PHATRDRAFT_12757 (ADH_2)
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PHATRDRAFT_12757 (ADH_2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N Sacchrp_dh_NADP AlaDh_PNT_C Methyltransf_25 Methyltransf_11 MTS Methyltransf_12 2-Hacid_dh_C 3HCDH_N TPMT TrkA_N
Motif
Other DBs
NCBI-GeneID: 7201214
NCBI-ProteinID: XP_002180508
JGI: 12757
UniProt: B7G0N4
Position
9
AA seq 340 aa AA seqDB search
MKAAIYRDFGGQICVEDVPIPQIASDGILVQVKATGVCRSDWHGWKGHDGDVRHHGLPFC
PGHELSGIVVKSGPNVSNLLVGDRVVAPFILSCGSCHYCDNHRSTVCLKQEQPGFTFWGS
FAEYVSIPRADWNVKKLPNNVSFIQAAALGCRFTTAYRAVLQQGRFQAGETIAVFGCGGV
GLSCVMIAAAKKAHRIIAVDVSKRALEKAKDLGATHVILCNDNTQVRNEVKELGPVGDGA
DVCIDAAGFPSSCENAVHSTRRAGRMVQVGLPIGDVSPNIPMGLVAGWEIEILGSHGFAA
DNLCSLLEMISNGSLNPGNLVEKQVSLAEGAQSLIDMDHG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccatctacagagactttggggggcaaatatgcgttgaggatgttcccatt
cctcagatcgctagtgacggaattttggttcaagtcaaggctacgggcgtctgtcgcagt
gattggcacggatggaaaggacacgatggagatgtacgacatcacggtctgcctttttgt
cctggtcatgaactcagtggaatagttgtcaaatcgggcccaaacgtttccaatctatta
gtcggcgatagagttgttgcaccgtttatattgagttgcggatcatgccactactgtgac
aatcatcggtccaccgtttgtttgaaacaagaacagccaggattcacattctggggatcc
tttgcagagtacgtatcgattccgcgagcggactggaatgtgaagaagttaccgaacaac
gtttcctttatccaggcagccgcgttgggttgccggtttactacagcctaccgagccgtg
ctccagcaaggtagattccaggctggtgaaactattgctgtttttgggtgtgggggtgtg
ggtttgtcctgtgtaatgattgctgccgcaaaaaaagcacaccgtattatagcggttgat
gtgtcaaaacgagcactagaaaaggccaaagatctgggcgcaacccacgtgatcctttgc
aatgacaatacgcaggtccgaaacgaggttaaagaattgggcccagtgggtgatggagcc
gacgtctgcattgacgccgctgggttcccgtcaagttgtgaaaatgccgtgcactctact
cgtcgtgccggtcgcatggtgcaagtgggtctaccgattggcgacgtctcaccaaacata
cccatgggactagttgcaggatgggagatcgagattttgggctctcacggctttgcagca
gacaatttgtgttcattgttggagatgatttctaatggctcgttgaatccaggcaatctg
gtcgaaaaacaagtgagcttagcggaaggagcacaatcgctgatagacatggaccatgga

DBGET integrated database retrieval system