KEGG   Phaeodactylum tricornutum: PHATRDRAFT_12757Help
Entry
PHATRDRAFT_12757  CDS       T01075                                 

Gene name
ADH_2
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PHATRDRAFT_12757 (ADH_2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHATRDRAFT_12757 (ADH_2)
  Lipid metabolism
   00071 Fatty acid degradation
    PHATRDRAFT_12757 (ADH_2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PHATRDRAFT_12757 (ADH_2)
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PHATRDRAFT_12757 (ADH_2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 340 aa AA seqDB search
MKAAIYRDFGGQICVEDVPIPQIASDGILVQVKATGVCRSDWHGWKGHDGDVRHHGLPFC
PGHELSGIVVKSGPNVSNLLVGDRVVAPFILSCGSCHYCDNHRSTVCLKQEQPGFTFWGS
FAEYVSIPRADWNVKKLPNNVSFIQAAALGCRFTTAYRAVLQQGRFQAGETIAVFGCGGV
GLSCVMIAAAKKAHRIIAVDVSKRALEKAKDLGATHVILCNDNTQVRNEVKELGPVGDGA
DVCIDAAGFPSSCENAVHSTRRAGRMVQVGLPIGDVSPNIPMGLVAGWEIEILGSHGFAA
DNLCSLLEMISNGSLNPGNLVEKQVSLAEGAQSLIDMDHG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccatctacagagactttggggggcaaatatgcgttgaggatgttcccatt
cctcagatcgctagtgacggaattttggttcaagtcaaggctacgggcgtctgtcgcagt
gattggcacggatggaaaggacacgatggagatgtacgacatcacggtctgcctttttgt
cctggtcatgaactcagtggaatagttgtcaaatcgggcccaaacgtttccaatctatta
gtcggcgatagagttgttgcaccgtttatattgagttgcggatcatgccactactgtgac
aatcatcggtccaccgtttgtttgaaacaagaacagccaggattcacattctggggatcc
tttgcagagtacgtatcgattccgcgagcggactggaatgtgaagaagttaccgaacaac
gtttcctttatccaggcagccgcgttgggttgccggtttactacagcctaccgagccgtg
ctccagcaaggtagattccaggctggtgaaactattgctgtttttgggtgtgggggtgtg
ggtttgtcctgtgtaatgattgctgccgcaaaaaaagcacaccgtattatagcggttgat
gtgtcaaaacgagcactagaaaaggccaaagatctgggcgcaacccacgtgatcctttgc
aatgacaatacgcaggtccgaaacgaggttaaagaattgggcccagtgggtgatggagcc
gacgtctgcattgacgccgctgggttcccgtcaagttgtgaaaatgccgtgcactctact
cgtcgtgccggtcgcatggtgcaagtgggtctaccgattggcgacgtctcaccaaacata
cccatgggactagttgcaggatgggagatcgagattttgggctctcacggctttgcagca
gacaatttgtgttcattgttggagatgatttctaatggctcgttgaatccaggcaatctg
gtcgaaaaacaagtgagcttagcggaaggagcacaatcgctgatagacatggaccatgga

DBGET integrated database retrieval system