KEGG   Phaeodactylum tricornutum: PHATRDRAFT_13004Help
Entry
PHATRDRAFT_13004  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PHATRDRAFT_13004
Peptidases [BR:pti01002]
 Cysteine Peptidases
  Family C86
   PHATRDRAFT_13004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 171 aa AA seqDB search
MSSSCLLPASGFHERQKLAMCAVHAINNIVQSSKYSKTDFDSICEQLSPLIWFNPHRSAF
SIGNYDVNVVLLVLQAENCSVLWHDRRGLVTTHDLDIHDAILWNVRSETWLGRIAGWRHW
IALRVRDGCWTNYDSLFTEPQDIGNSKQCAALLNSEKDGHVLLIHFPCTED
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctcttgcctcttacccgcttcaggatttcacgagcgccagaaacttgctatg
tgtgctgttcatgcaataaataacattgttcagtcatccaagtactccaaaacagatttt
gattcgatttgtgaacagttgtcgcccttaatatggttcaatccgcatcgaagcgctttc
agcataggaaattacgacgtgaatgttgttttgctggttttacaagcagagaattgttct
gtcctctggcacgatagacgaggactagtcactacacacgatctggatatccacgatgct
attctctggaatgttcgttcagagacgtggttggggcgcatcgctggctggagacattgg
attgcactccgggtacgtgacggttgttggacgaattatgattcccttttcacagaacca
caagatattgggaacagcaagcaatgcgcagctttactcaattccgaaaaagatggacat
gttctgctcatacatttcccgtgtaccgaggattag

  All links  
No link information was found.   
DBGET integrated database retrieval system