KEGG   Phaeodactylum tricornutum: PHATRDRAFT_13123Help
Entry
PHATRDRAFT_13123  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
pti  Phaeodactylum tricornutum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 328 aa AA seqDB search
MPSVQTVKEIYIDSFLEMLDYPQIHTPDDQADFADGLESLYAKHANVLVQMAKGAFQLRK
AVRSGQVKGSRNNEDNDDDRHHVSFECMEECHKFLDRFYTSRIGIRVLAGQYLALHSNHA
SSGSSLSDDTPNKHDDKYIGMICLKTSPSAIVRRAASDATTMCLRKYGIAPRVVVQGRLD
LTFPYIPTYLHYILLELLKNALRATTEHHASLAGPLPSVTVVIADGDDNEDVVIKIMDEG
GGIPRSRIEKVWSYLYTTADPSIQEGFIGENDHSSASPIAGLGYGLPISRSYVRYFGGDM
DLMSMEGYGTDAFLYLKRIGDSKEPLPV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcggtacagaccgtcaaagaaatctacattgacagctttctagaaatgctggac
tatccacagatccatacacccgacgaccaagcggactttgctgatggtctggagtctctg
tacgccaaacacgctaacgtcttggttcaaatggccaagggagcttttcaattgcgcaaa
gccgtaaggtctggtcaagtaaaaggcagccgcaacaacgaagataatgacgacgaccgc
catcacgtgtcctttgaatgtatggaagaatgccataaattcctcgatcgattctataca
tcccgtatcggtattcgcgttttggctggacaatacttggccttgcacagcaaccatgcc
tcgtcgggatcaagcttgagtgacgatacacctaacaagcacgacgacaagtatattggt
atgatatgcctgaaaacttcgccgtcagccattgtccgccgggccgctagtgacgcaacc
accatgtgcttacgcaaatacgggatagctccacgagtagtggtccaagggcggctcgat
ttgacctttccttacatacccacttatttacactacattttactcgaactgctcaagaac
gccctgagagccaccacggaacaccatgcatcccttgctggtcctttaccatccgttact
gtcgtaattgccgatggggatgacaatgaagatgtggtgattaagattatggacgaaggt
ggagggatccccagatcgcgaatcgaaaaggtctggtcgtacctctacacgacagccgat
ccctccatacaagaaggctttattggagagaatgatcacagcagtgcttcaccgatcgct
ggactgggatatggtttgccaatttcgcgtagctacgtgcggtattttggtggcgatatg
gatttgatgtccatggaaggatatgggacggacgcctttttgtatttaaagcgcatcggt
gattcgaaagaacccttgcctgtttaa

DBGET integrated database retrieval system