KEGG   Phaeodactylum tricornutum: PHATRDRAFT_13894Help
Entry
PHATRDRAFT_13894  CDS       T01075                                 

Gene name
DHLTA_2
Definition
(RefSeq) dihydrolipoamide acetyl transferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00010  Glycolysis / Gluconeogenesis
pti00020  Citrate cycle (TCA cycle)
pti00620  Pyruvate metabolism
pti01100  Metabolic pathways
pti01110  Biosynthesis of secondary metabolites
pti01130  Biosynthesis of antibiotics
pti01200  Carbon metabolism
Module
pti_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHATRDRAFT_13894 (DHLTA_2)
   00020 Citrate cycle (TCA cycle)
    PHATRDRAFT_13894 (DHLTA_2)
   00620 Pyruvate metabolism
    PHATRDRAFT_13894 (DHLTA_2)
Enzymes [BR:pti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PHATRDRAFT_13894 (DHLTA_2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 7202591
NCBI-ProteinID: XP_002181796
JGI: 13894
UniProt: B7G3I7
Position
13
AA seq 435 aa AA seqDB search
AQDYPAHTVFPMPALSPTMESGTITAWHKQEGDAFIAGDVLCSIETDKASVDFEAQDDGV
LAKILHQADAALDIVCGTPICVAVEEHQAVAAFADYTVAHDSSAESGGAASHDESTPSQP
TPPHPTRNVPSILLPAARHLAESRGLNATVLSGSGKGGRVTKGDVLQAIADGTLPPLTAD
PTATVPTELPVPHVHAAEGSFADTPNSKMRKIIASRLTESKATVPHFYTSMEIPLDAILA
LRKQLASQHDVKVSVNDFIIRSSALALRDVPEVNGTYDAHSDTVRLNDSIDVSVAVATPT
GLITPIIFQSDQLGLSALTATIRDLATRARDGKLAPHEYQGGTFSVSNLGMFGVDEFSAV
INPPQAAILAVGGGARRVVPGTYVVDAPENRTSPTVHTILTGRLSADRRVVDEATAALFL
AALERYLRQPALLML
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gcccaggactatccggcacacactgtcttccccatgccagccttgtctcccaccatggag
agtggcaccattacggcttggcacaagcaggaaggtgacgcctttattgcgggagacgtt
ctctgttccatcgaaaccgacaaggcctcggtggatttcgaagcccaggacgacggcgtc
ttggccaagatcctacaccaggccgacgccgctctcgatatcgtctgcgggacgcccata
tgcgtcgctgtagaagaacaccaagccgtagccgcctttgcggattacaccgttgcccac
gattcgtccgcggagtcgggcggcgccgcgagtcacgacgagtcgacgccgtcccaaccc
actcctccgcatccaacccgaaacgtcccgtcgattctcctaccggcggcacggcatttg
gcggaatctcggggattgaacgctaccgtcttgtccggatccggcaagggaggacgggtc
accaagggagacgtcctacaagccattgcggacgggacgctcccacccttgactgcggat
cccaccgctacagttcctaccgagctacccgtgccccacgtccatgccgcggaaggatcc
tttgcggatacgcccaacagcaagatgcggaaaattatcgcgtcccggttgacggaaagc
aaggcgacggtgccgcacttttacacgtccatggaaattcccttggacgccattctggcc
ttgcggaaacaactggcgtcccagcacgacgtcaaggtctcggtcaacgactttatcatt
cgctcttccgcactcgcactccgcgacgtgcccgaagttaacggcacctacgacgcccac
tccgacacagtgcgtctcaacgactcgattgacgtcagtgtcgccgtggcgacccccacg
ggtctcattactcccattatcttccaatccgaccaactgggtttgtccgcactgaccgcc
actattcgcgatttggcgacccgcgcacgcgacggcaagctcgccccgcacgaataccaa
ggcggcaccttttccgtcagtaacctcggcatgttcggcgtggacgaattctcagccgtg
atcaatccgccccaagcggccatcctggccgtgggtggcggtgcccgtcgggtcgtcccc
ggtacctacgtggtggacgcgccggagaaccggacgtcgcccacggtacacaccattctg
acggggcgactcagtgcggatcgacgggtggtggacgaagccaccgccgcgctctttttg
gcggctctggaacggtatttgcggcaacccgcgctactgatgctgtag

DBGET integrated database retrieval system