KEGG   Phaeodactylum tricornutum: PHATRDRAFT_14003Help
Entry
PHATRDRAFT_14003  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PHATRDRAFT_14003
Protein kinases [BR:pti01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   PHATRDRAFT_14003
Spliceosome [BR:pti03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    PHATRDRAFT_14003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 361 aa AA seqDB search
DDTVGHFRGDPGTLLLDRYKVLRQVGIGTFGKVLDCTDLRRSASGPTSEVVAIKVVRDVP
RYYESALIEAKIVRQVNRRGGRGLSHCVNLHDAFTFQGHYCIVFESLGPSLYDFMKLHNY
KSFPMECVQDFAIQLLETLEFLHSFRLIHTDLKIENVLLMNAREVSFSHGDRRHQQYVPA
STRIKVIDFGGACYDEEKKSTVINTRQYRAPEVILGTGWSMPSDIWSTGCILAELYQGEL
LFSTHDNLEHLALIERTLGPFPRHLVERAKKLGGSSDSSSRRFAREAFDSKGRHRMGRVL
SSENAAYVQKAMPLERLIASHDDWFLELLRRMLVIDPQERATAHECLQYLTRVRRNVPRF
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gacgacacggttggacattttcggggagaccccggtacgcttctcctcgatcgatataaa
gtgttgcggcaggtcggtattggtacatttggtaaggttttggactgtaccgatctgcga
cggtcagcgtccggaccaacgtcggaagtcgttgccatcaaggtggttcgggatgtacct
cggtactacgaatcggccctgattgaagccaagattgtgcggcaagtaaaccgccgaggt
ggacgcggcttatcccactgtgtcaacttgcatgacgcttttacttttcaaggtcactac
tgtatagtatttgagtctttgggaccaagtttgtatgattttatgaagctacacaactac
aaatcctttcccatggagtgcgtgcaagattttgcgattcagttgttggaaacattggag
ttcttgcattcgtttcgcctgatccatacggatctgaagattgaaaatgtgttactcatg
aatgcacgtgaagtatctttttcgcacggtgatcgtcgacaccagcaatatgtgccggca
tcgacccgcatcaaggttattgactttggaggagcctgctacgacgaggaaaagaaatcg
acggtgatcaatacccgtcagtaccgggctcccgaagttatcctgggaacgggctggagt
atgccgtctgacatatggtccaccgggtgcattctagcagaactgtaccaaggagaacta
ctgttttcgactcacgacaatttagaacacttggccttgatagaacgtacgctgggacct
tttcctcgccatttggtggaacgcgccaaaaaattgggaggtagtagtgacagcagcagt
cgacgatttgctagggaagccttcgactcgaaaggtcggcatcgcatgggacgtgttttg
tcgtccgagaacgccgcgtacgttcaaaaagcaatgccgctggaacgactcattgcctcg
cacgacgattggttcttggaattattacgacgtatgcttgtgatagacccgcaagaacga
gccacggcgcatgagtgtttgcaatatttgacacgagttcgccggaacgttccgcgcttc
ctttga

DBGET integrated database retrieval system